CAZyme Information: H257_09230-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_09230-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678		75163.65	6.3947

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913135:330468-332560(+)

Full Sequence      

MPEEEPSLGFMTTTTDRTAGGRKETVWVDEPQNSPILSPGGTKFRKGRRICHLVYLVIFL
VIGGITALVIVTTSSSQHSSPPHHKDDELAANVAILKLPVFKYACTENQCVYQNLTKAEV
LSGVPTMGDGLMSLRVCEMTCGNGSMLPMPQSIAIASKPGETVAVDVTSFSHHVTTSDSA
LVKAMQAAFNEHMAAKLKLAVGGVQDKGASVNVVGTIASASTALGLDTDESYEVSIAATT
VTITAKTAFGYRHGLASVVQLVDWCDVSRSFRMVKAVTIQDKPAYKYRGVMLDTARNFHS
MAAIKRLVRTMGMHKLNMFHWHITDSSSFPIEIKFEPKFNLYGNYQSDMAYSQANVRDIV
AYAKTHGVQVIPEVDAPAHAGAGWQWGPDYDVGELTLCWANNPLAYNECYEAPCGQLNPM
NEHVYGLLDKVWVEMADMFESDVLHMGGDEVFTKCWKRSPVVSDAVANTTDDAEYFEISA
KFQERVQTNLWKHAPSRKVMLWSSELTSSLYSKYLPKDKIIVHTWAGIQNGNEPRHMADA
GYQYVASFQDRHYLDCGHNGIDRKDNGWCAPYKTWQVIYEQVLNPNITEDLMPLALGGEL
VLWTEVSGEASMDVRIWPRAAALAERAWTNPTTRWDKAMARMTIATYRVVESGSGSDLIQ
PHWCRQHPGECPLIVWPL

Enzyme Prediction     

EC	3.2.1.52:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	280	630	1.8e-85	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119332	GH20_HexA_HexB-like	1.46e-117	285	636	1	330	Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. The hexA and hexB genes encode the alpha- and beta-subunits of the two major beta-N-acetylhexosaminidase isoenzymes, N-acetyl-beta-D-hexosaminidase A (HexA) and beta-N-acetylhexosaminidase B (HexB). Both the alpha and the beta catalytic subunits have a TIM-barrel fold and belong to the glycosyl hydrolase family 20 (GH20). The HexA enzyme is a heterodimer containing one alpha and one beta subunit while the HexB enzyme is a homodimer containing two beta-subunits. Hexosaminidase mutations cause an inability to properly hydrolyze certain sphingolipids which accumulate in lysosomes within the brain, resulting in the lipid storage disorders Tay-Sachs and Sandhoff. Mutations in the alpha subunit cause in a deficiency in the HexA enzyme and result in Tay-Sachs, mutations in the beta-subunit cause in a deficiency in both HexA and HexB enzymes and result in Sandhoff disease. In both disorders GM(2) gangliosides accumulate in lysosomes. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
395590	Glyco_hydro_20	6.02e-95	285	630	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
119333	GH20_chitobiase-like	5.04e-62	285	642	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
119338	GH20_chitobiase-like_1	7.59e-59	285	642	1	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
226056	Chb	1.32e-54	230	650	206	636	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55750.1|GH20	5.42e-186	93	674	13	583
AIG55828.1|GH20	2.06e-164	203	674	595	1062
AIG55611.1|GH20	1.60e-155	91	674	12	576
CAD7080794.1|GH20	1.38e-121	99	674	47	616
AJO25049.1|GH20	1.74e-121	103	672	51	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NSM_A	9.86e-107	100	671	4	570	Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 from Ostrinia furnacalis [Ostrinia furnacalis],3NSN_A Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with TMG-chitotriomycin [Ostrinia furnacalis],3OZO_A Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with NGT [Ostrinia furnacalis],3OZP_A Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with PUGNAc [Ostrinia furnacalis]
3S6T_A	2.12e-106	100	671	7	573	Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 V327G complexed with PUGNAc [Ostrinia furnacalis]
3WMB_A	1.50e-105	100	671	4	570	Crystal structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with naphthalimide derivative Q1 [Ostrinia furnacalis],3WMC_A Crystal structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with naphthalimide derivative Q2 [Ostrinia furnacalis]
5Y1B_A	1.78e-105	100	671	4	570	Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with a berberine derivative (SYSU-00679) [Ostrinia furnacalis]
5Y0V_A	4.94e-105	100	671	4	570	Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with berberine [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49010|HEXC_BOMMO	2.80e-109	100	671	28	594	Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori OX=7091 PE=1 SV=1
sp|Q06GJ0|HEXC_OSTFU	9.38e-106	100	671	26	592	Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Ostrinia furnacalis OX=93504 PE=1 SV=1
sp|Q8WSF3|FDL_DROME	1.42e-100	132	671	83	659	Probable beta-hexosaminidase fdl OS=Drosophila melanogaster OX=7227 GN=fdl PE=1 SV=1
sp|Q9SYK0|HEXO2_ARATH	8.64e-86	212	674	98	573	Beta-hexosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=HEXO2 PE=1 SV=1
sp|D4AYT4|HEX2_ARTBC	1.10e-72	229	677	139	611	Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01353 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999829	0.000177

TMHMM  Annotations     

Start	End
53	75