CAZyme Information: H257_08364-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_08364-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	KI913131|CGC1	85763.24	6.3780

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913131:711195-714418(+)

Full Sequence      

MATTQEESTPLLPTTVEKRKVRDRQRRQLMCFGGVAALAACAVGVWWWTNETPLDLFIPD
VPLTPWTSDVMEPPFEKEANLIRPHLISEDLLKRPIPTNAWWTNLLISDSHGQNTGAGQV
TLSPYTIASWPHVMQVSYGDDRRVEEPSKIEEYFSADLTFGTVVPSISREVVAFDPLTVH
LQYRNESNGTTFTVLLARGSPYVSINYTLSAPMITTTYFNILWCNNASISKTPTTVAGST
FTVVTQIEHQKTQEWLIFFPTNVTVSINSTSFAVQDETFSGIVRAAIVPRNSPDGTAAHL
RQHASIVPVASAVSLSSNVTTGIMEFTWKTVATTTDSIAAASLLMLAHPHHVDSLVPSAT
RNRSSTTTVMHSSSSGDPFASSTPSILLGPFGHRTIKGNMSFVLGNSWLLADTFQEVGFN
SRHPIAADAIAPLLVALKNDSNFTPQALDPYFFGKEIARQARLVLIADELNQGTTKLLDQ
LEDWLLPWFVGKNFDFFVYDTVWGGVCSVKGLRGVFWMTDFGNGWYNDHHFHYGYFIYAA
AVVAKYRPDFVLRHRAALMSIVRDIANNSPHDPYFPLARHMSWFDGHSFASGVYVLDGGK
SQESVSEAINAYYGVYLLGQALSMPAVEHMGRHLMTLEMRAATTYWQTTDAIYGSVYAQN
QMTGQIGSTKVTYATWFGPEVEHMHLINLMPFTPVTELFVSAAFVTREYPILAKALHRPA
APMDEIWKGYTYLDHAIVDAKAAWAEVATLKSFDDGNSRANSLYWIATRPTN

Enzyme Prediction     

No EC number prediction in H257_08364-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	85	765	9.4e-145	0.9855305466237942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	4.20e-82	425	763	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.94e-75	61	763	54	749	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	8.49e-24	95	416	14	307	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19047.1|GH81	7.78e-191	73	769	71	815
UIZ24045.1|GH81	4.47e-119	71	567	74	606
AGP40408.1|GH81	1.80e-110	71	770	56	702
AUX36386.1|GH81	2.03e-107	71	770	67	713
UQA58532.1|CBM6|GH81	3.16e-107	95	770	300	921

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.07e-48	96	770	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.32e-48	96	770	66	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.29e-46	96	770	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.40e-36	384	766	272	653	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.03e-24	380	766	291	689	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	4.40e-49	75	767	61	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	3.12e-41	63	759	4	692	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.18e-40	341	759	475	892	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.56e-37	254	767	626	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.02e-37	317	745	664	1083	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.988068	0.011923

TMHMM  Annotations     

Start	End
29	48