CAZyme Information: H257_07792-t26_2-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_07792-t26_2-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		49191.75	6.4349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913129:1081804-1084299(-)

Full Sequence      

MAHVQPATGSVLNSSSQSTSDPEGVLPDDVSPLEVYNFDVNKYKDGSFQLVTAVDPRVFL
SGRFLRHDEYASRKTKVNSVQFDWPHCGFSIRVKRTRGVGIRLKGEGNYFNVFVDGEFKC
ILRASLKASCCDVVTFDDDIGDEEHTVTISKRTEPQMRGAVSTFKVCTFYGFVVDKAAVV
LPCDPGFRHRIEFIGDSDTCGFGNEGVATSSKGIFGMKGRMENVYNGYACIAARMFHAEA
HILAWSGKGVKSNLGDWGPNMSSMWKNAIASREFPWDLNSWQPHAVVINLGTQDLFPPAS
SEAEIVEAYTALLEDVRQHRPDAHIFCVVCDENCMSGEDDLVNRSRISLQLQEITKVAMS
RVKKMDLRMHYAFIKIQGGLDDSDFANMRHYAVSGHVKFAQALAKEIAFRTEWDVTADVQ
TMPYPQAKSQILVPSDKQCAIS

Enzyme Prediction     

No EC number prediction in H257_07792-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	190	407	2.8e-51	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	8.92e-28	190	407	1	168	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
407839	CE2_N	1.67e-14	79	182	12	106	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
404371	Lipase_GDSL_2	9.18e-08	193	356	1	134	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.11e-06	191	405	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26481.1|CE2	9.15e-172	15	436	57	513
CCA14218.1|CE2	2.04e-118	14	434	28	457
ADO75380.1|CE2	6.03e-35	49	420	37	375
ACL76504.1|CE2	6.89e-34	56	413	110	436
QKJ95934.1|CE2	1.24e-33	51	414	29	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	1.36e-31	55	413	8	333	Chain A, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	3.57e-31	55	413	8	333	Chain A, ENDOGLUCANASE E [Acetivibrio thermocellus]
4XVH_A	3.77e-19	81	413	14	329	Crystal structure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]
2W9X_A	2.58e-11	79	315	47	268	The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]
3U37_A	8.14e-06	185	325	162	334	An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P10477|CELE_ACET2	2.40e-29	55	413	489	814	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
sp|B3PDE5|CE2B_CELJU	1.29e-10	79	315	47	268	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_07792-t26_2-p1.