CAZyme Information: H257_07412-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_07412-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735		78849.76	6.3963

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913128:717850-720939(-)

Full Sequence      

MTLLSDQQKTTLAAIVSAFVAPLSEEDATGVVAEHLKDVQDNSVARTKALEAFAQMPPPD
LGVVDTIASKLAFFPADKRNEFLQVLDLLATGWGTYLLTGSTRFVPFHDLSLADREHALL
NLSQSRFALLRSLFRALKALSHLCTFAQQVTADTGDTNPYWEPLQYTGIPSEKPRPPRSH
FHEPSFEDVDALAELANGGAIELETDVVVVGSGAGGGVVAAELAQAGHRVLVLEQGKFHH
PADSTFGEMEEYEKQYADSVFLVSEDGSMQMLAGKTWGGGTAVNWSASLRPPPEVLDEWV
HKHELPYFGTAAFQEALDIVCKRAGVSTDHIKHSVPNQVLLDGCAKLNFPVHAIPQNTNG
HTHSCGFCSLGCPYGEKQGSHVTWLQDAAAAGAKFIAGCKVDKVTYTANVATGVKGTVLD
GKVSIVVRAKTVVSACGGVYSPALLLRSGLQNPNIGRNMRLHPVTTIYGFLPTKVVKSWE
GSIMTSVTDVVSNVHGNGYGARLETPTSLLGATSSLLPWRGNLDFTRLLLQVPHLSGVVT
IVRDCDSPIQVKIDATGRPRVHFELGPKDAKSMVEGMIASAKILLSQGAIEVNTSHLSVP
ALRLDTPEDRANPVECETSQAWFRQLRATGIPVNSLGIFSAHQMSSCRMAATPAKGAVNS
DGETWDVQGLYVADSSVFPTASGVNPMITTFAMGYSVAQSIKANLALEEAMGAPRTRPPP
LAPPSLWSRLMSWFV

Enzyme Prediction     

No EC number prediction in H257_07412-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	204	704	6.7e-51	0.5032362459546925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	8.26e-62	262	464	11	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	2.66e-31	222	704	25	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.78e-23	554	695	13	141	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	0.001	642	723	473	548	choline dehydrogenase; Validated
274143	pyranose_ox	0.001	642	705	483	546	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	4.82e-126	35	708	68	737
QRD04249.1|AA3_3	7.81e-09	204	469	13	308
CBX94187.1|AA3_1	5.05e-08	189	459	15	304
APA07372.1|AA3_1	7.09e-08	201	450	26	298
AQA29310.1|AA3_1	1.17e-07	206	462	31	305

PDB Hits     

H257_07412-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	2.36e-109	38	705	49	746	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|O65709|FAO4A_ARATH	7.03e-109	86	701	64	718	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|B5WWZ8|FAO1_LOTJA	6.72e-108	85	701	95	740	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q9LW56|FAO3_ARATH	4.16e-103	85	705	90	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	5.86e-96	5	705	28	742	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_07412-t26_1-p1.