CAZyme Information: H257_07411-t26_5-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_07411-t26_5-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein, variant 5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608		66051.90	8.6492

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913128:709782-712963(-)

Full Sequence      

MMTFPRSKFQYSFHPLRYTCSMTAMAKVAGKGNPITLETDVVVIGSGAGGGVVAAELAQA
GHRVLVLEKAVYFHPADASFNELQGFWDHYESAALLTSEDLSMMLLAGSAWGGGTFINWS
ASLPPPHELCHEWATTYNLPYFKSQAFQDAISTVCTRAGVSAEAVLHNVPNQVLLDGAIK
LGYPVEAVPQNTNGHVHECGFCTLGCPYGEKQGSHVTWLRDAADAGAKFVDGCYVDKVTY
VKDAASGVEATVLNGSVRLVVKAKTVVCCAGSLHTPALLLRSGLRNPNIGRHLRLHPVAT
VHGFFPHKQVQSWSGSILTTVCNVVRNIHGHGYGARLEIPASLMGLTASLLPWRSNADMH
RLMLQYPQLVNMIVLARDLDSVSSVVIDADGRPRIHFQLGSKDGQSLVEGLVAGIKVLLA
QGAVEVNTTQFHLPPLRLQSKEDLANPVECATTQRWIAQVRALGAVQNSIGIMNAHQMGS
CRMGSTPEMGAVNPDGETWDVRGLYVADASLFPTASGVNPMVTTFAMAYSVAQFIKANLS
DRSNCGRKIFSTSSSTSWWAVWWAIVWAKDGHLRRALKVLVVAFALWRHHTHVWSFLKKR
LGQHAIKR

Enzyme Prediction     

No EC number prediction in H257_07411-t26_5-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	36	544	3.9e-49	0.5161812297734628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	2.27e-58	90	298	5	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	8.60e-39	56	538	25	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.30e-22	388	529	13	141	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	1.59e-10	185	535	181	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	1.53e-06	230	528	219	524	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	4.93e-109	34	539	216	734
UPK99904.1|AA3_2	5.63e-10	25	538	1	529
USW51778.1|AA3_1|AA8|CBM1	2.82e-08	26	537	255	800
UPK99666.1|AA3_2	3.71e-08	215	544	208	538
CAD7092717.1|AA3_2	4.39e-08	38	541	32	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DVE_A	9.00e-06	231	535	233	504	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94BP3|FAO4B_ARATH	2.34e-101	33	542	232	745	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|B5WWZ8|FAO1_LOTJA	6.59e-101	31	532	229	737	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|B5WWZ9|FAO2_LOTJA	3.64e-100	18	539	209	746	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|O65709|FAO4A_ARATH	4.09e-100	37	531	222	714	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9LW56|FAO3_ARATH	9.49e-93	23	539	208	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_07411-t26_5-p1.