CAZyme Information: H257_07200-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_07200-t26_1-p1
• CAZy Family: GT76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		65363.61	6.8072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913127:1170700-1172436(-)

Full Sequence      

MKVPSSLAIAAAFAAASTPDPKFYGINYDTRTSEWGGCKDTTEIDTDFVALNQLTGRIRI
YGIDFNCTKLVLKTAANRGFKVWLGMSSEVGVDALKGLVEDGMINNDDVLGVEVSSEALN
RYYVLGPGNTAGTSDRHGIETVLDHLRTVRSYLRSQNLTFPVVITDTMDMYSMFPQLYEA
VDMVAVNHFSFWENKTAQEGAHFTFTRFQEHQFLAKRAGKLIELHATGWSSVGEEPISWD
QGIFTRDLRNLVALQNLNSYYFTAFDSRFGTNKIERSFGIKDVNRDMKFNMRLRVKPLYP
VRLWAAGGNVIKAYGYWNTDDSANKNPGRVYAAKPYIGPPGNLNDEIWQWDLEYNRLYST
SSNMCLESFGNEARTLYTAPCSEDEPNQKWKYANKTIVSQNHARFCIHVDVDHPPNDDGT
LEVAIFPCNRLPHQEISLQGTSFEALEIKIKAHGGILTETLGNLTWQTTRVKGLQNLGRQ
TWTYNPVTQLIASSSRDYENRHCLEAPWRINSARLVFKLCSSDVNQKWVVNDITGQIHHA
THIGFCLDGHNNVDGLVYLAWCDKNNPNQQWSIKPLRA

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.38e-25	23	285	45	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	2.47e-11	476	571	34	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	8.46e-07	496	575	6	86	Ricin-type beta-trefoil lectin domain.
238092	RICIN	9.34e-06	476	573	32	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	1.32e-05	341	434	26	113	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55545.1|CBM13|GH17	4.29e-118	9	573	7	568
AIG55960.1|CBM13|GH17	4.99e-110	1	573	1	569
AIG56029.1|CBM13|GH17	4.46e-97	1	572	1	558
AIG56030.1|CBM13|GH17	6.35e-96	1	574	1	574
AIG55846.1|CBM13|GH17	2.01e-86	1	573	1	564

PDB Hits     

H257_07200-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEV5|BTGC_NEOFI	4.83e-11	23	233	384	597	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	8.41e-11	23	293	384	679	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	8.41e-11	23	293	384	679	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	9.89e-10	23	293	351	646	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|A2QN74|BTGC_ASPNC	3.71e-08	23	293	380	675	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.760130	0.239885

TMHMM  Annotations     

There is no transmembrane helices in H257_07200-t26_1-p1.