CAZyme Information: H257_07057-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_07057-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655	KI913127|CGC6	74092.45	9.6796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913127:808789-811353(-)

Full Sequence      

MSITQSNLLMLLPLATTSRQRHTLLAIIASNVIERPIIPAIRFSLESTTNANATLDYRFD
VAGIKELGYVLGLPAVVITSNRIRVHRDEALCILLGRLAFPVRFHTMSRTFGRSRSSLCE
IFLHVVNDLYERWGSLLFFNKKLVQKNINRYCAAVASKGAPLSNVFGFIDGTKVQTCRIT
TTGTGDNLQKQIYSGHKRIHCLNYQAVTVPDGLCVHFFGPVEGRRHDTTMLRLSGLITYL
GQHRGVFDGKLMYGDPAYGIVPYLISGFKGNNLSAQKLEFNKWMSRVRQSVEWNFKLLKT
LWSYITFKMLAKIRRRRKYMGLVSALVLFVVVIVVCLNSSMVSSMQQATTAQWSLAALTT
SNSTDLQPNSSGLSANHLAVNRADFPAAPTAPRRLAYMLYATDARTVCNALIMARNIRAT
GTPRSIPIVTLVASDVAPDIAKQLVDPFNNFVVEVVAPWQQSRVHLSHEYASSLTKLRIF
EERGGFDKVIYLDSDAWVQRNLDHLFHLGNAVLWAPHAYYIRESYVFGSTLLVFSPSNDV
VAALAAALETPPRPNYFDMDVLNDLFRLDCGYLPNHYVVLSYTLNDNYTWSFKTKADRMA
STYVYHYSPWLGVGKPWQTPRSILNDKDQAYEPLYYDLYARYWQQEDTLCASWLK

Enzyme Prediction     

No EC number prediction in H257_07057-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	396	619	8.1e-27	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	1.69e-24	396	617	2	238	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
404270	DDE_Tnp_4	1.78e-20	169	325	1	150	DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.
133018	GT8_Glycogenin	1.66e-17	407	639	13	237	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
411206	transpos_IS5_4	3.83e-10	154	317	105	266	IS5 family transposase.
227884	Gnt1	1.38e-07	395	525	71	205	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55795.1|GT8	2.34e-64	393	652	118	371
UPK95458.1|GT8	2.31e-14	396	581	10	192
QRW19876.1|GT8	1.09e-12	392	629	55	302
BCS16636.1|GT8	9.20e-11	394	629	54	299
BCS05078.1|GT8	1.11e-10	394	629	54	299

PDB Hits     

H257_07057-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q947G8|GOLS1_SOLLC	6.02e-07	427	618	51	254	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.991734	0.008283

TMHMM  Annotations     

Start	End
319	341