CAZyme Information: H257_07041-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_07041-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793	KI913127|CGC2	89872.21	6.7081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913127:747688-751845(+)

Full Sequence      

MKVPLVPALGVAVVTLLAVSLALAWRLHRLTQLLVDHPRAVAHAVVPPSTPATTPGFALP
EWRQTFKRAEYTCVGWRDTSSCALDAPPVDELPSHDCFATISPGSPGYCEIQHKQTGAIR
RLYTQCDGIRVPFRCIQAGDIWEYAVDTTTYVYSHTPSVQAQNLRGWNTMRGIVMSLYPQ
ALASGYAAIRQLRAVGCLLPIEIWIVQEEVVASDPVLRALTTNFNCMVRYVEDPLARRFF
VKPYAIYHSVFDQVLFLDADNFAVRDPTYLFSLPEFTTTGAMFWPDYWQPNNTLFGVHER
SLLWEVLGVPFIDMFEQESGQLLIDRQKSATPLRVLMRMAFRLPRVIHDMDLIWGDKDLF
RLAWMQAHRPFHMIQKPPGSAGLKHHQFDLFCGHSMVQHDPDGHILFLHRNTFKLTGAVQ
APLLWGHIQDFNGGVATVDYVVRFAHGGEAFQNFRCFGNDTNYSPAFDVRSFSEFPFASI
ETSLNAVLLVVLDVRFVDILQVSFKCPSPPLNHTHPVLPSTPSFLTVNSTIAGDVVLAAI
VAPPSTTTTTASTPPPLATPRVAYMLYATDARTVCNAVIMYTLYLQEAGAVVVPVEPWQQ
PLVHISDEYAMSLTKLRIFEQRGYDKVVYLDSDAVIQRNLDHLFHLGDAILWAPHAYYIG
EQYAFGTTLLVVTPSDAAFAKLQHALETPPRPNYYDMDVLNDLWRLSCGYLPSHYVVLTP
SLNEDLVWAFKDKQERINKTYVHHYSRGSDLAKPWHVSKSMLETRNPAFHPLFYDLFYLY
WVHEDKYCKWIQS

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	171	400	1.6e-44	0.9924242424242424
GT8	610	756	8.1e-21	0.5486381322957199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	4.11e-30	563	758	2	241	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
402574	Mannosyl_trans3	1.81e-28	171	400	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	1.38e-17	585	785	48	239	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	7.62e-07	609	644	153	188	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	7.71e-07	609	755	98	266	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24000.1|GT71	2.20e-119	58	484	96	560
UIZ24059.1|GT71	3.05e-116	63	484	132	588
CCA25989.1|GT71	3.22e-107	61	484	86	532
UIZ27901.1|GT71	1.82e-95	63	443	62	447
UIZ28362.1|GT71	2.52e-93	63	432	658	1041

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	3.38e-06	593	682	79	165	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q947G8|GOLS1_SOLLC	4.23e-11	581	755	64	253	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|Q59KJ7|MNN21_CANAL	2.42e-10	188	401	263	527	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q4HVS2|GNT1_GIBZE	1.16e-09	561	755	154	392	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q59WF4|MNN2_CANAL	2.68e-09	186	310	202	327	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2
sp|A6ZQE9|MNN5_YEAS7	3.48e-09	186	400	165	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000001

TMHMM  Annotations     

Start	End
5	27