CAZyme Information: H257_06715-t26_4-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_06715-t26_4-p1
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460		53227.52	6.9356

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913126:835944-837742(+)

Full Sequence      

MDLPNMRKSQYYDEPERRSDMQLRMTPVYNVQDKTHVEEPSFTHTIRHIWPLIFGLAFLA
GSSYGVATLVKTYEVDPTYLNMTFAEFREEQVLGEQCRAVDHAVPWKELQRKIRGCRRFE
YYDPMHNDCQACPAHQPTDKVFAVFWETQSNCQHLVGNPNIRFVTHVMWSFSTLRADGSV
EQNLQYWDDKHIKNCMAQLRMRCIKSIVALGGANNRDMFYGLRQPENVERFTASAVSLVK
KYGFDGIDVDDETANMVINKGKWKDFHGQTVVDYLTALRKGRGFTSREIYRYICVQFIAL
DKARVPDEPRYILSWDEFPQSWTPSDCEIYNNNDGWHRCWEPRITDLVDWVNIMYYNMFG
YPQFGNPFYDLMAKHLPERVLPAIKDPNKIVLGACTGQGCVLPQPDGQDVMNAGNGSAYY
GGTMLWSATIDILLENSTSLRRMGRAGNYGVKMPFRAPHP

Enzyme Prediction     

EC	3.2.1.14:12	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	143	393	4.2e-18	0.6351351351351351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	8.09e-17	142	374	1	190	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
395573	Glyco_hydro_18	1.90e-13	164	393	23	219	Glycosyl hydrolases family 18.
119365	GH18_chitinase	6.35e-13	164	394	26	259	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	1.13e-12	146	393	9	232	Glyco_18 domain.
225862	ChiA	1.54e-11	140	394	39	310	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56010.1|GH18	1.06e-117	80	457	31	390
AIY40744.1|GH18	1.13e-06	136	378	26	245
QDW64534.1|CBM5|GH18	1.32e-06	208	360	156	281
QKD47693.1|GH18	2.26e-06	158	252	344	456
AXA51221.1|GH18	2.68e-06	161	426	47	297

PDB Hits     

H257_06715-t26_4-p1 has no PDB hit.

Swiss-Prot Hits     

H257_06715-t26_4-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999944	0.000062

TMHMM  Annotations     

There is no transmembrane helices in H257_06715-t26_4-p1.