CAZyme Information: H257_06715-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_06715-t26_1-p1
• CAZy Family: GH19
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		51036.97	6.6771

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913126:835944-837742(+)

Full Sequence      

MDLPNMRKSQYYDEPERRSDMQLRMTPVYNVQDKTHVEEPSFTHTIRHIWPLIFGLAFLA
GSSYGVATLVKTYEVDPTYLNMTFAEFREEQVLGEQCRAVDHAVPWKELQRKIRGCRRFE
YYDPMHNDCQACPAHQPTDKVFAVFWETQSNCQHLVGNPNIRFVTHVMWSFSTLRADGSV
EQNLQYWDDKHIKNCMAQLRMRCIKSIVALGGANNRDMFYGLRQPENVERFTASAVSLVK
KYGFDGIDVDDETANMVINKGKWKDFHGQTVVDYLTALRKALDKARVPDEPRYILSWDEF
PQSWTPSDCEIYNNNDGWHRCWEPRITDLVDWVNIMYYNMFGYPQFGNPFYDLMAKHLPE
RVLPAIKDPNKIVLGACTGQGCVLPQPDGQDVMNAGNGSAYYGGTMLWSATIDILLENST
SLRRMGRAGNYGVKMPFRAPHP

Enzyme Prediction     

EC	3.2.1.14:12	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	143	375	2.4e-21	0.6351351351351351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	8.36e-21	142	356	1	190	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
395573	Glyco_hydro_18	3.08e-17	164	375	23	219	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.25e-16	164	376	26	259	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	4.30e-16	146	375	9	232	Glyco_18 domain.
225862	ChiA	5.29e-15	140	376	39	310	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56010.1|GH18	5.27e-116	80	439	31	390
AIY40744.1|GH18	4.74e-10	136	360	26	245
AXA51221.1|GH18	1.13e-09	161	408	47	297
AYO43345.1|GH18	4.75e-09	161	408	47	297
AMO96349.1|GH18	1.05e-08	140	342	17	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MNJ_A	7.40e-08	145	375	9	237	Crystal Structure of GH18 Chitinase from Cycad, Cycas revoluta [Cycas revoluta],4MNK_A Crystal Structure of GH18 Chitinase from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta],4R5E_A Chain A, Chitinase A [Cycas revoluta]
6BT9_A	1.23e-07	204	342	158	286	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6KST_A	7.82e-07	164	399	33	283	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	7.82e-07	164	399	33	283	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
1ITX_A	1.53e-06	144	342	65	251	Chain A, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G5EAZ3|CHIB1_EMENI	1.39e-06	164	375	30	253	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
sp|Q92222|CHIB_EMEND	1.39e-06	164	375	30	253	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999944	0.000062

TMHMM  Annotations     

There is no transmembrane helices in H257_06715-t26_1-p1.