CAZyme Information: H257_06709-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_06709-t26_1-p1
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602	KI913126|CGC1	68126.22	6.9230

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913126:820300-822108(-)

Full Sequence      

MWAQCSQRELSSTAAAATSNQVIEVASLLDARVTSVSSSKSESSSRCTIPPRWYKLTRFL
MGVTIAGVAVVAGFKIYFMLAPFPRDVVFHPSLNNIVMPVDRVSSLWRPDEFQCLGWRAV
EGCDPTGARKPWNDHNCNEPIKRGMAGFCEVRNRTSGEVFRVMATTCRGIDDHHEYTCNM
ATEFTDFSIKAVNYRHNEPLVVSSLTDAPTRGIAMSVYTPVLASAYAVIRSLRAMKCVLP
IELFYHPGEIDLTNPVVVELTGKYNCNLRPILNKAAKKFKSKPYAIYHSAFDQVLFLDSD
NFPTRDPTFLFDAPEFLDTGAVFWPDFWQPDYSIFNVNSQSLLWQLLDMAPFGDFEQESG
QLLVDRRRAPAALDKLMFYTMEGRLLEKLELVWGDKDLFRFAWHNTSTPFHFIETPPALG
GRYDAVDDRFCGVAMMQFDPQGDILFIHRNTYKMTGRQEQVPLLTHMQVFNATTRAAYEV
HHTGAGVGLGICWALKDDVPSYIVAMKDTAAAHVESHALHHAMEAGITMGIEPEIVHRVE
ATSWWRSPLEWLVCLMLWGGVATILLAALHWVSFRSVFGDKKLHWFDRYAGKKRKLSEYP
IV

Enzyme Prediction     

No EC number prediction in H257_06709-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	211	439	1.6e-45	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	4.82e-35	211	439	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.004	291	336	90	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27901.1|GT71	1.40e-132	91	541	48	522
CCA25306.1|GT71	1.56e-115	85	524	39	531
CCA20955.1|GT71	8.88e-115	101	525	87	548
UIZ28362.1|GT71	1.39e-114	84	471	633	1041
UIZ24000.1|GT71	2.06e-98	92	486	85	523

PDB Hits     

H257_06709-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38069|MNN2_YEAST	8.22e-15	225	439	185	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q59KJ7|MNN21_CANAL	2.11e-14	229	447	264	534	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|A6ZQE9|MNN5_YEAS7	9.98e-14	225	443	164	437	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	9.98e-14	225	460	164	454	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q59WF4|MNN2_CANAL	2.19e-12	225	448	201	479	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999915	0.000088

TMHMM  Annotations     

Start	End
59	81
552	574