CAZyme Information: H257_06228-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_06228-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	KI913125|CGC1	47215.50	8.5837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913125:531304-533284(+)

Full Sequence      

MKARTAGIFAIGLIIRLACVLWAEYQDRTMPVKYTDVDYDVYTDASREILQGNSPFDRTT
YRYTPILAYMLLPNVYLHEAWGKLLFVASDMIVGYLLYAILMMRAMPEASAINYTMWWLY
HPFSINISTRGNADTVVVLLCLLTIYFLMKKHLVVAAVFYGLAVHFKIYPIVYALSFLVF
LDEDYDSSIKPIQTTAGVAAKAWHWLNRTRLAFGLISGGVFVVLTAGFYLIYGYTFVFEA
YLYHFTRTDNRHNFSMYFYDLYLRYGTNSGFVVGLVAFLPQFLTLFNISLRCGKDIMHAQ
FLLTMAFVVFNKVCTAQYFLWYSAYLALVLPTTDLKGWQGAAIIGAWFGGELHWLYWAYE
LEMMGRNTFFPIWVAGLGFFAVNIGIMALFIQSHHHHPLFARGMIVPLTKG

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	127	390	3.2e-89	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	2.81e-129	1	403	6	427	GPI mannosyltransferase
252941	Mannosyl_trans	5.60e-71	127	391	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	2.93e-149	1	405	1	407
AAH01803.1|GT50|2.4.1.-	1.17e-108	1	402	14	419
NP_660150.1|GT50|2.4.1.-	1.17e-108	1	402	14	419
BAB18567.1|GT50|2.4.1.-	1.17e-108	1	402	14	419
CAH05413.1|GT50|2.4.1.-	1.17e-108	1	402	14	419

PDB Hits     

H257_06228-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54IA4|PIGM_DICDI	2.42e-118	5	395	25	431	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1
sp|Q9H3S5|PIGM_HUMAN	2.08e-109	1	402	14	419	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	2.08e-109	1	402	14	419	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q4R4E1|PIGM_MACFA	4.17e-109	1	402	14	419	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1
sp|Q500W7|PIGM_ARATH	4.83e-109	1	402	16	436	GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIGM PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.672030	0.327974

TMHMM  Annotations     

Start	End
7	26
84	106
127	149
159	181
211	233
266	288
301	323
338	357
369	391