CAZyme Information: H257_05874-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_05874-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	KI913124|CGC2	40367.20	7.0604

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913124:676187-677816(-)

Full Sequence      

MEEPAPKKPKVTHDEVDGVAKVPPQELVSFVVPAHNASSTIDDCLASICNITYRPLEVAV
YDDASTDDTFDKLQAWVPKCAAAGVTLHAIEKKKDTPGGAGYAKNRAAEVCTGAYFAFLD
SDDMALPHRVDVQLAMAKNDPSVIVGANFTRIPEGSTWHYTAWANALTDEQLVLQQYREC
TIIMPTWFMAKARFEFVGGFDEAKTSATIPEDLIFFLKHLELGGTLKKSNDTLVIYRHSS
GSVCSKLPRRVLLRTRLESFERRVLSQWPTFTIWGCGRDGKAVFNELSSASKRKVVAFCD
VNEKKIGTKHHDQVTRINIPIIHFRDAVPPIVCCVSMGRTDGELEANVRSLNLVHGVNFW
HFI

Enzyme Prediction     

No EC number prediction in H257_05874-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	29	161	4.3e-21	0.7529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133063	beta3GnTL1_like	4.52e-69	31	242	2	214	Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine . This family includes human Beta3GnTL1 and related eukaryotic proteins. Human Beta3GnTL1 is a putative beta-1,3-N-acetylglucosaminyltransferase. Beta3GnTL1 is expressed at various levels in most of tissues examined. Beta 1, 3-N-acetylglucosaminyltransferase has been found to be essential for the formation of poly-N-acetyllactosamine. Poly-N-acetyllactosamine is a unique carbohydrate composed of N-acetyllactosamine repeats. It is often an important part of cell-type-specific oligosaccharide structures and some functional oligosaccharides. It has been shown that the structure and biosynthesis of poly-N-acetyllactosamine display a dramatic change during development and oncogenesis. Several members of beta-1, 3-N-acetylglucosaminyltransferase have been identified.
132997	Glyco_tranf_GTA_type	8.15e-25	31	223	2	151	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
395426	Glycos_transf_2	9.58e-23	29	189	1	158	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133055	GT_2_WfgS_like	5.73e-17	29	237	1	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
223539	WcaA	4.59e-16	27	162	4	129	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7243467.1|GT2	6.53e-87	28	362	7	345
CAB3224887.1|GT2	2.67e-84	27	359	7	346
AAH96875.1|GT2	4.17e-83	32	362	1	337
AAI58333.1|GT2	4.40e-83	28	362	10	350
AFE70141.1|GT2	1.73e-80	25	362	10	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	3.59e-11	27	223	376	559	Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	3.59e-11	27	223	375	558	Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
5HEA_A	1.76e-06	26	123	5	95	CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6GV29|B3GNL_RAT	4.75e-81	17	362	5	356	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1 OS=Rattus norvegicus OX=10116 GN=B3gntl1 PE=2 SV=1
sp|Q67FW5|B3GNL_HUMAN	5.36e-81	25	362	17	360	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1 OS=Homo sapiens OX=9606 GN=B3GNTL1 PE=2 SV=2
sp|Q3U129|B3GNL_MOUSE	1.07e-79	27	362	15	356	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1 OS=Mus musculus OX=10090 GN=B3gntl1 PE=2 SV=1
sp|A0A0H2UR96|GLYG_STRPN	1.04e-13	26	264	3	242	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
sp|Q8L0V4|CHS_ECOLX	1.94e-10	27	223	433	616	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_05874-t26_1-p1.