CAZyme Information: H257_05100-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_05100-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1014		114476.46	7.7613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913122:854381-859069(-)

Full Sequence      

MAADQKLLHGESNPSSTDYVTSDTPNMAALPVINDTDENTIRVFGWMHKQGTRVIRGPGA
KSWRRRFFCLEGQKIYYFHEPVDARKYFNSRSPELCIGSIDLRTAFKLEQSDRLDLPSKG
LVIHTKIRKWLVCPETDAEFKMWFDALETTIMTNDAGNVIQRHLPNVREYVMKGRTSYRV
FYFLFLITALIELAGIVLWFPLGIEPCNLKLRTANCSDIMKKYIPEEQPICGPEPFNGLW
NPPDFYKKQAGMVGVQCFRVPTLAHWVSYFCFYFAEFISILLGALYYLGMWKPVRRGAHY
LREFNPPFPPDKWPTVDIMLCHYAEPAEDTMSTLEAIMKLDYPCEKLHVYICDDGGFKTK
FTPGNPIPEVVVNKGVIENAGDVRYELAHFMYERVLDLDGEGQGIGYTRAVEMEVNEWRQ
SHTTVKMPTPTNPRVAARIDCAVGSERDDYDYRYAGLPRVTYVGRFKPPTHHSKAGNINN
VLYNEGACGRYAIILDNDMKPHPMFIQATLPFFFDSPASTKTFRCRAPGCSDIAKITCTL
CVQAGVPEATISYCSNDCFVASNHVHSQVHRRQARTSKVNRTTCTTCGGKVDLKSGTCSG
CKKAMGRRTSVGTQEAAQYALAMGDHYNDDVQNNQVGYVQTPQYFEDCLQLRLGDPCGHR
NSTFFDSAQTGMDGYECASFAGTNAIFRRSALDSVCGIAYGSLTEDAFTGKLMIDKGWKG
LYFRKDFEGEEGERIRLAEGAVPETVSASLAQRKRWAKGNFQIFLRRKTSLVDPTWTPPA
DIELPPPRKVNGFMRWVFFMNLTIYPIGSFPALFFFYITGYFLFSGNAPIYTAGLRLLVA
LVPKIVVQSVLTAMMNRTVDNNDVLRSQQTWFSYAYVHVLAVIDAIYWKITDKEAAWANT
GALGGNSTMELPNILVFFAMVFGVIWSIVRFFVGYNSAETTHGTPLLFGSMFLGLFTASQ
LMPMVRMSLQTYFGWSHKALTDQGNVVGSFSLAIVLSVLCLWVYIENPHDNVWV

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	2.03e-32	314	764	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	3.47e-18	262	764	208	492	cellulose synthase catalytic subunit; Provisional
215121	PLN02189	2.90e-15	291	1006	305	1022	cellulose synthase
224136	BcsA	3.62e-14	633	926	165	433	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	1.86e-13	635	766	113	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEZ51040.1|GT2	0.0	41	1013	80	1031
ABP96909.1|GT2	0.0	37	1013	68	1021
AXF53810.1|GT2	0.0	41	1013	69	1018
ABP96913.1|GT2	0.0	41	1013	69	1018
ABP96905.1|GT2|2.4.1.12	0.0	41	1013	69	1018

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	3.94e-12	631	764	378	505	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
7D5K_A	9.90e-08	291	813	305	830	Chain A, Cellulose synthase [Gossypium hirsutum],7D5K_B Chain B, Cellulose synthase [Gossypium hirsutum],7D5K_C Chain C, Cellulose synthase [Gossypium hirsutum]
6WLB_A	6.54e-07	291	1011	238	975	Structure of homotrimeric poplar cellulose synthase isoform 8 [Populus tremula x Populus tremuloides],6WLB_B Structure of homotrimeric poplar cellulose synthase isoform 8 [Populus tremula x Populus tremuloides],6WLB_C Structure of homotrimeric poplar cellulose synthase isoform 8 [Populus tremula x Populus tremuloides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	5.13e-25	444	879	568	880	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|P19449|BCSA1_KOMXY	2.07e-12	631	764	254	381	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	2.07e-12	631	764	256	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	2.70e-12	631	764	254	381	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|Q8X5L7|BCSA_ECO57	2.01e-11	631	764	378	505	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999822	0.000198

TMHMM  Annotations     

Start	End
180	202
266	288
797	819
829	851
872	891
911	933
946	968
983	1005