CAZyme Information: H257_05075-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_05075-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		34300.64	6.8554

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913122:776921-777904(-)

Full Sequence      

MKTALCLVALATLASDVLGHGRLLKPPHRGYIGRLPGYQFVPINYSDNGLSAGGIGATKD
GLHGVCGDPYTDKVPRPHENGGLYGTFATETSRAIGACYSPGSTVDVTVQVTANHMGYFE
FGLCKLNKKDDVETETCFQTLAQPTGETRWPVPAGNLDFTIKNVLPKDVTCEGDAHCVLR
WHYVGGNNWNGAATNPNAGVWGQEHFWNCADIYISNTCGAAPLPTSAVPVTTQATVAPTT
AAPVSTAAPVTTKGTTTVAPVTAAPTTAAPATTKATTLAPVTPAPTSAAPGDKCQGNRNT
CYWPEARQTVPYAQSDCALFPTFVWCP

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	20	212	4.2e-54	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	9.05e-10	20	212	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV82437.1|AA15|1.14.99.53	4.88e-213	1	327	1	327
KDO27651.1|AA15	7.36e-108	1	327	1	303
EQC31691.1|AA15	1.80e-105	8	327	40	311
KDO27652.1|AA15	2.07e-104	10	327	10	311
EQC31690.1|AA15	4.16e-104	10	327	10	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	1.50e-29	20	215	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

H257_05075-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999757	CS pos: 19-20. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in H257_05075-t26_1-p1.