CAZyme Information: H257_04763-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_04763-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700	KI913121|CGC6	76732.84	8.5172

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913121:962851-965220(-)

Full Sequence      

MGWSVVVVGAAAFVAFGNTMFSHFTWDDRGAILMNLDVRTDVTPLRDLFAHDFWGMNLSS
PQSHKSYRPLTVATFRLNYAVHGLHPHGYHITNVLLHVVVSILVVSTGRVLCSPSSSSTP
VLAGLLFAVHPIHCDSVASVVGRADILCTAISLLALLAYNQRLRHVQHSRRLVWTMVAIG
CTCLATMAKETGFTMFAVLLAMEWSSDTRYSKAQSGALMVAGVMFLAWRVQMNGSSTTLY
TWSIYENEFAHLPSFVSKAMSYAHVHTLYLWKLLWPQYLCYDYGWNTIHAVTSIYDVRNL
ASSVAYMAVVGAVGTSASHRRTSPLFVLLVLGICPFVPASHVMFPVGTILAERLLYLPSV
GFCLVVGYATERVLLAATPASKPKLVALLGLVLAVATSRTIRRNLDWHDEHTLFQSALSV
APTSVKVLTNLGQDILPKDARTAVLYLERAVALMPSYSLGHLNLAAGYAALKKPLQAMHH
LVQSIELVQEPKAYTSLGQHFVEFWESHVGAGQSTLHTAAHLVQTALDVGATYPSASYGQ
AKVAFALGNMGATLQSLAITRTANAYVASRGYDLNEVVDPCFVDTLAGLAWEHMNTTTAL
AFYDRAMMNASTFWDCASLVNNAAACFHRANRSMDALKLLDKATKRHPLQVVLWTNAGYM
AESVGHQAQALTYFEAALRLEPDLAHLRTKLELAFKQQQP

Enzyme Prediction     

EC	2.4.1.109:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	77	207	9.2e-34	0.9236641221374046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	1.38e-12	241	310	5	74	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	5.03e-07	617	699	1	83	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.36e-05	583	679	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	2.28e-05	413	486	23	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	1.22e-04	438	698	2	249	Tetratricopeptide (TPR) repeat [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAF83034.1|GT105|2.4.1.109	1.56e-70	3	445	21	502
Q5T4D3|GT105|2.4.1.109	2.16e-70	3	445	21	502
BAC25886.1|GT105	8.05e-70	3	445	20	502
BAC32288.1|GT105	1.06e-68	3	445	20	502
BAC28522.1|GT105	1.06e-68	3	445	20	502

PDB Hits     

H257_04763-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5T4D3|TMTC4_HUMAN	3.84e-71	3	445	21	502	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	1.88e-69	3	445	20	502	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q6ZXV5|TMTC3_HUMAN	1.33e-66	6	490	11	512	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q8BRH0|TMTC3_MOUSE	2.39e-65	5	477	14	504	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	1.80e-62	11	536	43	633	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.942666	0.057361

TMHMM  Annotations     

Start	End
4	26
171	193
213	230
325	347