CAZyme Information: H257_04760-t26_3-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_04760-t26_3-p1
• CAZy Family: GH17|CBM13|CBM13
• CAZyme Description: hypothetical protein, variant 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		66110.88	8.1548

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913121:953233-955153(-)

Full Sequence      

MKGSPSATLSPLWQGTVPLLCVALLAFAVFANTLSCGFVWDDRAAILTNRDIRTDDNTTA
VGDLFVHDFWGTPISSASSHKSFRPITVLTFRLNYAVGGFDPWGYHLLNVVLHSITSALV
VVVGRRVMSIAPSSSQVHRAPVLAGLLFAVHPIHCDSVASVVGRADVLCTLVSLVAFTCY
DTAISDRTTTKWMHFILSIGLIVLATLCKELGATTLGMLVVLDLLQSYRLSTQELLASPT
LGRLAVLVAFGTTAIAGRILLNGPHMLYPWTEMENDISLLPFGTSKVLTIAHTHAWYLYK
MAWPQYLSYDYGFRTIPIVHSMLDPRNISTAIAYTCVVTLVFASAWHSRTSPSLLLMASF
ALFPFVPAANVLFPVGTIVAERLLYFPSVGVCLLAGYTLDTALHRGSQRQQVALVGIATT
LLIVATARTLCRNRDWTDEVALFEASVKVAPWSTKVLSNLSKVLLNSDAPRAAAYLERAL
HVLPHYSIGHFNLGLAYVNMGKSLHCMDSLLKAIDVDHSLASYSYLGKYLFEFYATNQHD
KFRTDQPTHALATATKLLDFTLSHHHNLPTIVFTRGLIAYYADDFAAALPYVVAYRQLCL
QH

Enzyme Prediction     

EC	2.4.1.109:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	93	233	3e-36	0.9694656488549618

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	9.45e-11	270	338	6	74	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	3.89e-08	427	515	8	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.52e-06	455	532	2	81	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	1.63e-05	404	544	746	892	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
274350	PEP_TPR_lipo	0.004	426	566	335	470	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7262601.1|GT105	5.20e-78	24	513	13	506
BAE38405.1|GT105	3.71e-73	28	503	23	501
BAC32122.1|GT105	8.35e-73	28	503	23	501
AAI66274.1|GT105	1.71e-71	5	486	12	511
CAG26973.1|GT105|2.4.1.109	3.14e-70	28	513	18	506

PDB Hits     

H257_04760-t26_3-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BRH0|TMTC3_MOUSE	1.75e-72	28	503	23	501	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q6ZXV5|TMTC3_HUMAN	5.65e-71	28	513	18	506	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q5T4D3|TMTC4_HUMAN	1.18e-70	5	473	13	501	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	4.11e-69	7	502	26	563	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1
sp|Q8BG19|TMTC4_MOUSE	5.99e-69	7	473	14	501	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.773434	0.226567

TMHMM  Annotations     

Start	End
12	34
102	124
197	219
239	261
328	350
354	376
383	402
412	431