CAZyme Information: H257_04617-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_04617-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	KI913121|CGC4	53631.38	6.4520

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913121:393296-394765(-)

Full Sequence      

MPPSEHHASAVVVTTSSAIVMVTPDVEYKGSSKSTDALHRRRKTRLLQALATGLLVVGAV
VGALMISTSLHDASSAHDATVAAANGQVSVCYDSYDSRNMPDHFKRIKERFAGVRTFQTQ
GAFNHIEVAAQAGLQIYAGIWIQSGNVEGDMAAAVYGAKKYPGTVKAILVGNEELMVGLS
ASFVIDKVNRMKQLLREAGVSNVPVGSVQMDGSWFGNPGLADVCDVMGVNIHPFFSATDI
SKTRPIEDLKTRWQNLVNRFGHKSIVVTEAGWPTSGSPLNGHVPSTDTAKQFINDMRDWA
AGGGGGDMPAYFMFHDNPSKSMDFEKSFGLAGTDGVWKFDFNGPLQRSPSEVKGVVFVNT
ANDQVLAAAPLRKVEFHAKWGNDWVWDWSSQWTIRGPLIVTWDDYNKVDLCLDAYEGFNG
GTVHLWPCDTANGNQQWNYDGDAKLLRHATHDGFCLDMGNPNGGTPHLWTCHESWDPWVK
LQQLEWWTK

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.56e-24	66	329	23	299	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	1.58e-13	409	474	54	120	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.14e-12	406	476	7	76	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	5.50e-12	409	474	11	76	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.14e-11	409	474	52	117	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55518.1|CBM13|GH17	4.26e-104	90	480	22	403
AIG56197.1|CBM13|GH17	4.77e-85	81	485	22	548
AIG55595.1|CBM13|GH17	2.26e-80	83	483	13	555
AIG55519.1|CBM13|GH17	3.75e-80	88	483	18	548
AIG55926.1|CBM13|GH17	3.06e-76	79	456	13	366

PDB Hits     

H257_04617-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUT0|EGLC_EMENI	4.39e-12	139	296	90	266	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|B0Y9Q9|BTGE_ASPFC	7.24e-12	83	337	304	558	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	7.24e-12	83	337	304	558	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	2.74e-10	83	333	291	550	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|P53189|SCW11_YEAST	9.68e-08	114	296	316	509	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999947	0.000072

TMHMM  Annotations     

Start	End
46	68