CAZyme Information: H257_04616-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_04616-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	KI913121|CGC3	54212.84	5.9233

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913121:389736-391211(-)

Full Sequence      

MDVHTTLDDTCTMAQTPRNDILYAAAVDTCEDGIATTATEEEVVQTTNKWSKRRRAMVAL
ATALVVVGGIVAALVLVQAPNSTTVATVGTGGDVSVCYDSYNDVNIAAHFKTIRQRFTGV
RTYQTRGFRNAIDVAAEAGLKIYAGVWIRTDEGSINADMQAVVDGVRRNPSVVKGVFVGN
EELHEGIDQWTVLGRVRQMRQRLQAAGLGWVPVGSVQVDGNWAGAGALANECDLIGVNIH
PFFSAASVSTWNPIEDLKVRWNAMYNAYGGRAVLTETGWPTSGSQFYGHWPSFDTAKNYY
FQVLEWSKANGGNMPSHFMFHDNALKPTDFEKAFGLAWSNGVWKWDAPAATEVKGVVFVN
TANNQVLAAVPSSRTVEFHAKWGNDWVWDWSSQWTIRGPLIVTWDAANKVDLCLDAYEGW
NGGTVHLWPCDAANGNQQWNYDGNAKLLRHAKFTGFCLDMGNANGGIPHLWACHDSWDPW
VKLQQLEWWTK

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.05e-16	56	299	10	261	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	2.04e-12	411	476	54	120	Ricin-type beta-trefoil lectin domain.
238092	RICIN	4.63e-10	407	478	6	76	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	4.72e-10	411	474	11	74	Ricin-type beta-trefoil lectin domain.
238092	RICIN	5.10e-10	411	476	52	117	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55518.1|CBM13|GH17	4.82e-115	96	482	22	403
AIG55519.1|CBM13|GH17	6.50e-98	85	485	9	548
AIG56197.1|CBM13|GH17	2.29e-94	94	487	29	548
AIG55595.1|CBM13|GH17	5.39e-91	94	485	18	555
AIG56231.1|CBM13|GH17	1.59e-82	94	450	18	366

PDB Hits     

H257_04616-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y429|BTGC_ASPFC	2.27e-09	105	283	408	597	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	2.27e-09	105	283	408	597	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	1.17e-08	105	283	375	564	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|B0Y9Q9|BTGE_ASPFC	1.88e-08	91	284	319	509	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	1.88e-08	91	284	319	509	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999656	0.000365

TMHMM  Annotations     

Start	End
57	79