CAZyme Information: H257_04546-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_04546-t26_1-p1
• CAZy Family: GH17|CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663		74471.86	7.2476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913121:116517-118802(-)

Full Sequence      

MEQALQRVESPLYHNSRHLHGHGARRPIALWRFIVLGVGMLALCSVGLFYQVQYIHITAA
PQHLRADHVSSYSTILPTRRPTEAALPHRNPAPVPSALSTTQRHVDAEVDTIALPWPPGN
PYASYQCKGWRQTGGCDPDGVREPLNDKGCSAAISGGLSGYCEFHDPVKNDTIHFMKMSC
ESLRAHVAFSCNMTFDTVMFHRHAAVYRHPWNLQGDPRSRGYLNSSAFDPTPHSVATRPP
GRTWYADAVGDSPSRGIVVVVYEKALVPMYATLRYLRHDLNCTLPIEMWYRSDELSPHNN
TVMASMLALPEVHLREIRDPIATGFYVKPYVIFFSQFEQLLFLDADNVPLKDPSFLFTTA
EFQATGAVFWPDFWHPHNTIFNVHAKSFVWTLLDVPFIDMFEQESGQLVVDRSRCERALH
KLMFYALHRIEPQPPIKYSSMQFGPTLPVDANLIAALVLLWGDKDLFRLAWLSTNTSFHM
VSTPPGAIGMYGKPPKVNDRGEFVPGDNDALPDRFCGKAMVQYDVGNSTNQTPPEPLFVH
RNTVKLGRSNASRAKQWFAYQRIRPTVVAYKDVVDQYKIQAWRERTSCFGEPLGATETFE
LTDTASTVFEAAEGKLLKYADEAAAMLPPETTAPSTIKMSTNLPTPARSQPIKSRAAEPD
LID

Enzyme Prediction     

No EC number prediction in H257_04546-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	254	524	9.9e-45	0.9962121212121212

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	2.53e-33	254	524	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	5.01e-05	334	382	87	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24059.1|GT71	2.53e-91	123	627	139	599
AIG56191.1|GT71	3.08e-87	110	626	28	489
CCA25989.1|GT71	1.06e-85	25	568	9	480
UIZ24000.1|GT71	1.28e-83	123	620	102	564
UIZ29182.1|GT71	2.45e-83	125	636	66	499

PDB Hits     

H257_04546-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6ZQE9|MNN5_YEAS7	8.76e-10	252	483	147	410	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	8.76e-10	252	483	147	410	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|P38069|MNN2_YEAST	1.17e-09	225	524	134	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AD72|MNN24_CANAL	2.72e-08	323	524	365	558	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q5AP90|MNN23_CANAL	6.82e-07	248	483	167	426	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000024

TMHMM  Annotations     

Start	End
28	50