CAZyme Information: H257_04528-t26_3-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_04528-t26_3-p1
• CAZy Family: GH17|CBM13
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		60156.15	6.6259

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913121:56752-58665(-)

Full Sequence      

MYPKGGLPYLDKLIRRWAKTHNVAVLVSVHGAPGSQNGQDHSGAISKDILWAKYNENVRA
TREFAAFLVDRYQNDVAFLGLGLLNEPVSGLSNSTGFSNSTSGVDFATMSQYYRDVVADV
RAISPDVLVVTAPFLNKQYPGKEEACMQAFEPAITHAWHDWHPYVIWGNENQSELELVEA
AAARTRDVAAWTGRPLLLGEWSLVTPGGSFSDTSSPLFQQFVSAYLGMLKQAKGGWTYWS
WKKSSDDVSTTQVEKWSLRSMLNLANSLQQSEDEDNAMVIVGSDGHGLHLPNTPVQQGWR
LVNDPAWIAENGRAPEWWYNRRTHTLRTNRFDGLCLTAVDSNQGMQAQGVICDGAASSQQ
KWQLEDHRIILAGHTPRRCLSSNLTLSSCVHRDRTQYFNMGREKVVIRRTRTPHVAFGAT
EGGAALSQPNQTQWIVDHGQRTVQNVATGKCLDAFQNRDAGVVHVLDCSDDNVNQKWVYD
VATSQLRHATHVGYCLDVCATNGTARGGFHLIECHDTTDANIANQQFDLVGAAVQSAVPQ
QTVS

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	5	259	4.3e-27	0.68

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	2.16e-12	430	527	36	126	Ricin-type beta-trefoil lectin domain.
225344	BglC	6.19e-11	9	245	117	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
238092	RICIN	7.68e-10	427	529	32	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	1.99e-07	427	530	27	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
214672	RICIN	7.50e-07	329	477	3	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56138.1|GH5	6.74e-73	2	497	129	619
UIZ29004.1|GH5	2.96e-59	2	271	148	409
UIZ29069.1|GH5	5.92e-50	1	262	156	404
UIZ29723.1|GH5	1.31e-48	6	262	115	355
UJR33211.1|GH5	8.51e-48	1	263	139	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3N9K_A	5.52e-09	2	261	107	377	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
3O6A_A	7.33e-09	2	261	107	377	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
4M80_A	7.33e-09	2	261	107	377	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
1CZ1_A	1.27e-08	2	261	102	372	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
1EQP_A	1.27e-08	2	261	102	372	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XN12|EXGA_ASPFC	1.93e-12	2	242	129	384	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	8.05e-12	2	242	129	384	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	1.42e-11	2	242	129	384	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	1.42e-11	2	242	128	383	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q96V64|EXG_BLUGR	2.62e-11	2	245	126	388	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_04528-t26_3-p1.