CAZyme Information: H257_03647-t26_2-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_03647-t26_2-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38469.19	9.3126

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913119:854034-855510(+)

Full Sequence      

MSPATPPRHVVVLVLGDVGRSPRMQYHAVSLSKMPNTKVTLVGYEGERCVPQLLAQPNIH
LRTFAPVKVSRSLFVLSGPLKVLIQLCQLFWILLFTLGSIDVLMVQNPPTIPTLCVAWLT
CKLKRAKFVIDWHNFGYTVLALSIGESHAFVKIATTVERVFGQLADANFCVTKAMQGWLQ
NHWRIHATVLYDKPPEFFKPASIAEKHELFTRLADQLPAPWVVPSGNTTKPPKPMDTNAT
LLTTEIHSAVHDRLDRPAVLISSTSWTEDEDFGLLFRALVLLDARIVDDPAYPDVLVVVT
GKGPQKAMYLKKIQDMQLVRVHITTMYSFVILVPLYSNAQSQLA

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	8	327	5.9e-106	0.7294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	2.05e-115	20	327	16	299	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	2.32e-112	20	327	17	294	transferase, transferring glycosyl groups
340825	GT4_WbuB-like	4.24e-05	59	175	62	174	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21318.1|GT33	1.13e-112	8	331	81	413
CCA25895.1|GT33	1.67e-105	9	327	11	336
BBH01560.1|GT33	4.63e-81	12	327	78	421
CAG7866879.1|GT33	7.44e-81	12	327	10	341
VDC63845.1|GT33	7.44e-81	12	327	10	341

PDB Hits     

H257_03647-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8L7M0|TUN_ARATH	6.11e-79	12	327	9	340	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1
sp|Q921Q3|ALG1_MOUSE	8.29e-61	8	325	33	345	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|Q9BT22|ALG1_HUMAN	3.00e-60	8	325	33	345	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q5R7A2|ALG1_PONAB	1.17e-59	8	325	33	345	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG1 PE=2 SV=1
sp|P90522|ALG1_DICDI	2.42e-51	10	327	4	338	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_03647-t26_2-p1.