CAZyme Information: H257_03403-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_03403-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
760		83341.21	9.4488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913119:249226-251588(-)

Full Sequence      

MKEQLASMQTPLPTTISSHGTFMALAVPKSTRSVFRTLIGLRGLVAVAGVALVVVVVVQA
STPTIAVTNEISNAAAMQSLNCLLADAGTSPRCNFPSSAAQSWFAPPRNLHPSIRHDVPI
PTNRWWGNLISSPREDTVPEKRVWTNPYAVVLLPQGVIVSFPYGTRYFDGASGNVGGAKS
YSHAYSKDVTIGAITSSSQSFQVTSWDDLGVTVRQERAADQWLETSLVSGMAYVTAFYSK
LSPRVSTEHAIVSINEAGLVKRSTVTSTKFVLRLSNGQQWAVYTSSPLTLSVVTDRMLQQ
TDLFTGTIRVALVRTPQDIAAHDKYNGGPPLATTGSCDIGLLHFALAHHAAILTPDTAAP
IATMSRLESATRGAMIPLATIANQPPQWILAESLVPVELYPRQRPSRERIQHTRLLAHRK
ADIDAPWTMSVGGSYYFNGKLAQKYASLCLMESDRAVVGADDSLLRRCQAKLTNVLKLFT
SNAFTHRLVYDTVALTRPTRTPTLATPSTTTTTTTLGTGSRRRPAAIANVVHPTMPGLAA
LNQRVSFLIRDVANADAADADFPMFRMFDWFKGHSYSHGVTAAVDGKDLESTSEDVNFYY
AMALFGQATGDVRLERLGRLMLSVNVRSVQTYFLMTTSNEIHPPSIKVNHVPGIYFDNKV
HYTTWFSDARKSIHMIQMLPVTPVTEYVRTKQFVHEEWTDVLSKLPVVQHDQQHDAALSL
LYLNYATVHPDVAMAKLQTVALDDGLTRAWALYMAASRYV

Enzyme Prediction     

No EC number prediction in H257_03403-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	107	753	7.4e-125	0.9871382636655949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.19e-89	427	752	23	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.26e-84	60	756	40	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.34e-28	111	399	1	314	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56018.1|GH81	1.19e-193	95	758	73	755
AIG55599.1|GH81	5.89e-188	95	758	75	754
AIG56513.1|GH81	4.00e-178	101	758	92	769
UIZ29875.1|GH81	6.14e-161	86	758	84	792
UIZ20872.1|GH81	5.50e-159	100	757	100	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.00e-67	107	758	17	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.16e-66	107	758	42	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	7.87e-63	107	758	17	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	9.08e-18	545	749	447	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.52e-08	545	746	472	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.01e-52	95	756	16	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	9.55e-48	84	752	65	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.09e-45	107	752	421	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.88e-44	119	756	460	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.21e-44	223	756	183	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999979	0.000034

TMHMM  Annotations     

Start	End
38	60