CAZyme Information: H257_02730-t26_3-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_02730-t26_3-p1
• CAZy Family: CE2
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679		75365.31	6.4568

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913117:1658915-1661762(+)

Full Sequence      

MRWAAGVVVAAIACSLSLSNADNNVLGRFQDAIEIMQAGDTARAEQLLLRLSMVAPDDVD
VHVALGAMNHLEGNVDIATKYYNTVLTLDPTNDAVHGNLAFLNFKAGQYARAIDHFKASV
ATNPTKAQGMAHMIALAHHAMGDEVTAIMFFDLAQPLHDNDPHFHFDFAVSLQDEGLVTR
ANAEYNRALALDPNFPEAWLNIATLHLRYGSISTALRNFDRARRCTPLTPHLSLQIAINY
GVALETNGHAMEALVQFETAQTLLEWMDHSDREALDLFEHKTRTRRAIVSWVEYEETWDA
YLDATITRQLNRDAASSLVPFSSLMVDIPPHLRRRIAEAYAGATTPIRPPQSVDLNKNNR
RVHVGYLSHDFNNHPTAHLMEGLFVHHDTLSFEISTWSYGKDDGSAYRKSIPTLSEHFMD
VVLLGTNEAAAAIEAARVDILVDAQGHTLGQRHAIVAKQPAAIIVNFLVYPGTLGAAYVD
YMVSDRHVTPAEHADQYTEHLMMLPQSYQVNYYASYYQFSVQERHATAVTSSTSFVFANF
NKLDKVEPRVFNVWMAILRRVPHSELWLLHPTSSNTHDLIVANLVREAAQHGVAAARLRF
LPRVSKAEHLTRQRHADLFLDTFVYGAHSTATDALAGSLPVLTLAGGSFARCALDVGTCW
PNAAMFVVGSECRCLRTPT

Enzyme Prediction     

No EC number prediction in H257_02730-t26_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	124	652	4.5e-84	0.5191489361702127

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	9.96e-76	147	650	50	543	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
404688	Glyco_transf_41	2.00e-45	288	650	1	479	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
223533	TPR	1.43e-12	16	260	50	290	Tetratricopeptide (TPR) repeat [General function prediction only].
276809	TPR	8.12e-12	59	154	1	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	3.60e-11	33	261	371	594	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQO22916.1|GT41	2.60e-69	105	649	30	582
QQN61861.1|GT41	2.57e-68	70	650	29	583
ALF56607.1|GT41	2.91e-68	361	650	16	299
BAG05864.1|GT41	6.24e-68	308	649	202	542
ALF56465.1|GT41	2.21e-67	359	649	21	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JLB_A	1.75e-39	176	650	37	488	Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
2VSN_A	3.22e-39	176	650	37	488	Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
6Q4M_A	5.51e-38	288	659	158	644	Crystal structure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
5NPR_A	7.14e-38	288	659	152	638	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	7.18e-38	288	659	153	639	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	4.91e-53	284	644	504	873	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	4.76e-37	288	659	476	962	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|Q27HV0|OGT1_PIG	8.45e-37	288	659	476	962	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1
sp|O15294|OGT1_HUMAN	8.45e-37	288	659	476	962	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
sp|P81436|OGT1_RABIT	8.45e-37	288	659	476	962	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000692	0.999286	CS pos: 21-22. Pr: 0.9267

TMHMM  Annotations     

There is no transmembrane helices in H257_02730-t26_3-p1.