CAZyme Information: H257_02354-t26_2-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_02354-t26_2-p1
• CAZy Family: CBM47
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
716	KI913117|CGC1	79828.67	6.2913

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913117:624559-627926(-)

Full Sequence      

MRSRVTVAVVLALTWQPTIASPTAAEFIAQGVAYQLDTHDLIQAKHMYQAALSVSPDNVE
ALHLLGSVAYHEGHFHEAQEYLEQAISVSSSLDKSAMTHCNLAETLRKLHRPADGLHHGD
MCFNATGGSEFSLLVLAWLYKDLDEPSKAVDVLRRLVAMNDQHLEAWDTLGTIYLDNDDL
AAANDVFTHMIALDASDFRGYAGRGQVLHLQGHLDAAQADYDVALRINGQHDPTLQNVGI
LYQQLGHLDRAVAIYQQLLVRQPNNVALLNNLGAALLYTGRPDDARPYLEQSVRENPSNP
QSFVNLKTYYADSGDLDMARQMLQRAYDVSHADVLRIDMATLLPQVFTSQAHLDTTRRNM
HAAIDALLLLASSLHVENPEAFEIRPPFYLVYQGYNDLHLQTKLATLHSHSCPALHFTAP
HIALGVGTLFEFDKTFRRLRIGFMSKFFVPNHAHGMLLRGVLAHLNRQLFHVTLVVVPDP
QQQVDAGMAAAADAVKVLSMHLAHSQQEIAALELDVLVFADLMSEPMTYFAAFGRLAHVQ
AAFWGNPTTSGIPNVDYFISADAMESSPDPAVESHYSEQVVLLSGVGIWYDKPTVPAQLG
HRRDHHLEDEWTIYMCPQSVYKLVPQFDRVLFEILRQDPQGHVVLLEARYPQWTRQLRTR
LQQTINSTEMWNRVHFRPRVGGSDAFLKLLSVADVVLHPFPFGGSKTSAVGGSMHA

Enzyme Prediction     

No EC number prediction in H257_02354-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	262	707	1.4e-53	0.4269503546099291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274350	PEP_TPR_lipo	3.73e-16	21	328	260	595	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
226428	Spy	4.59e-16	433	708	254	524	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
223533	TPR	1.84e-15	24	327	22	291	Tetratricopeptide (TPR) repeat [General function prediction only].
276809	TPR	2.68e-13	165	259	2	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	1.45e-11	21	343	328	679	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAP54338.1|GT41	7.28e-67	336	708	138	497
BAI76932.1|GT41	7.04e-57	321	708	190	562
ACB77232.1|GT41	1.15e-54	325	707	334	700
BAZ61948.1|GT41	3.32e-54	336	708	441	796
BAZ15802.1|GT41	3.32e-54	336	708	441	796

PDB Hits     

H257_02354-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

H257_02354-t26_2-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999708	CS pos: 20-21. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in H257_02354-t26_2-p1.