CAZyme Information: H257_02354-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_02354-t26_1-p1
• CAZy Family: CBM38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		90065.45	6.1903

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913117:624175-627926(-)

Full Sequence      

MRSRVTVAVVLALTWQPTIASPTAAEFIAQGVAYQLDTHDLIQAKHMYQAALSVSPDNVE
ALHLLGSVAYHEGHFHEAQEYLEQAISVSSSLDKSAMTHCNLAETLRKLHRPADGLHHGD
MCFNATGGSEFSLLVLAWLYKDLDEPSKAVDVLRRLVAMNDQHLEAWDTLGTIYLDNDDL
AAANDVFTHMIALDASDFRGYAGRGQVLHLQGHLDAAQADYDVALRINGQHDPTLQNVGI
LYQQLGHLDRAVAIYQQLLVRQPNNVALLNNLGAALLYTGRPDDARPYLEQSVRENPSNP
QSFVNLKTYYADSGDLDMARQMLQRAYDVSHADVLRIDMATLLPQVFTSQAHLDTTRRNM
HAAIDALLLLASSLHVENPEAFEIRPPFYLVYQGYNDLHLQTKLATLHSHSCPALHFTAP
HIALGVGTLFEFDKTFRRLRIGFMSKFFVPNHAHGMLLRGVLAHLNRQLFHVTLVVVPDP
QQQVDAGMAAAADAVKVLSMHLAHSQQEIAALELDVLVFADLMSEPMTYFAAFGRLAHVQ
AAFWGNPTTSGIPNVDYFISADAMESSPDPAVESHYSEQVVLLSGVGIWYDKPTVPAQLG
HRRDHHLEDEWTIYMCPQSVYKLVPQFDRVLFEILRQDPQGHVVLLEARYPQWTRQLRTR
LQQTINSTEMWNRVHFRPRVGGSDAFLKLLSVADVVLHPFPFGGSKTSADALLLGLPLVA
MKTPLLRSRMAYSFYLHMDMLDCVASTEDEYIAIALRLGTDAVYRSDTARRIRERQHLLW
ENDEVVAEWERFLYNAVRSVATS

Enzyme Prediction     

No EC number prediction in H257_02354-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	235	797	2.4e-77	0.6099290780141844

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	4.90e-29	433	775	254	591	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
274350	PEP_TPR_lipo	7.33e-16	21	328	260	595	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
223533	TPR	1.45e-13	24	327	22	291	Tetratricopeptide (TPR) repeat [General function prediction only].
276809	TPR	6.67e-13	165	259	2	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	2.65e-11	21	343	328	679	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAP54338.1|GT41	2.69e-92	336	799	138	588
BAZ61948.1|GT41	3.46e-74	336	797	441	885
BAZ15802.1|GT41	3.46e-74	336	797	441	885
BAI76932.1|GT41	2.54e-73	321	798	190	652
QEM68384.1|GT41	3.55e-73	337	801	122	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	1.21e-07	514	774	238	487	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
5A01_A	4.29e-07	602	764	503	660	O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
5NPR_A	9.79e-07	602	764	508	665	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	9.79e-07	602	764	509	666	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]
5HGV_A	9.80e-07	602	764	510	667	Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens],5HGV_C Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RVB2|SPY_SOLLC	5.75e-11	535	774	588	821	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
sp|O82422|SPY_HORVU	7.61e-11	535	774	574	807	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare OX=4513 GN=SPY PE=2 SV=1
sp|O82039|SPY_PETHY	2.97e-10	535	774	588	821	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
sp|Q96301|SPY_ARATH	6.69e-10	535	774	583	816	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
sp|Q6YZI0|SPY_ORYSJ	1.36e-08	535	773	574	806	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999708	CS pos: 20-21. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in H257_02354-t26_1-p1.