CAZyme Information: H257_02284-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_02284-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		35029.48	6.4149

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913117:356948-357883(+)

Full Sequence      

MKTVVLLASVAAVQSAGLETYLPKSLFQSVFPKALPIYSYEKMIAVSKIYPAFANTGNVD
VDKREVAAFLGQIAHESGYLQYVEEINKSTMCEASADYPCAPGKQYFGRGPIQLSWNYNY
KDFGIAAGKDLVANPDLVAQDLWLVWWSAYWFWNVDKWNGNIHDVVGQPGGFAYTTYIIN
GGLECGPNPANKESEKSRIANYIKFANLLGVAPGDNLSCQTSAFPPSTLWPKPVTTETPP
LYDQDRHHIYPNHDQDHRHPHDQAHRYPHDDPLPSNQCNGNRNVCFWPLNQQVLPYAKAH
CQLFLWSVWCD

Enzyme Prediction     

No EC number prediction in H257_02284-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	19	219	3.6e-61	0.974025974025974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	5.93e-74	22	219	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	2.54e-53	38	219	25	232	Chitinase class I.
225720	COG3179	8.33e-11	66	183	42	187	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55513.1|CBM1|GH19	7.49e-123	9	232	12	235
ETV63620.1|AA15|GH19	6.20e-115	15	233	333	551
AIG56150.1|GH19	1.93e-105	6	239	8	228
ETV82190.1|AA15|GH19	4.98e-100	16	229	398	611
QRK07370.1|CBM12|GH19	7.41e-61	17	219	111	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IJ4_A	1.67e-55	20	219	5	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	3.43e-55	20	219	6	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
2CJL_A	4.56e-52	27	219	8	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
1WVU_A	1.86e-48	27	219	69	265	Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	5.21e-48	27	219	69	265	Chain A, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P21226|CHI2_PEA	8.28e-48	36	219	93	301	Endochitinase A2 OS=Pisum sativum OX=3888 GN=CHI2 PE=1 SV=2
sp|P06215|CHIT_PHAVU	2.55e-47	38	219	103	309	Endochitinase OS=Phaseolus vulgaris OX=3885 PE=1 SV=1
sp|P36361|CHI5_PHAVU	1.36e-46	38	219	102	308	Endochitinase CH5B OS=Phaseolus vulgaris OX=3885 PE=3 SV=1
sp|Q41596|CHI1_THECC	2.32e-46	38	219	99	306	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|Q8GUD7|CHIL_HEVBR	4.67e-46	38	219	79	286	Probable inactive chitinase-like protein LaCIC (Fragment) OS=Hevea brasiliensis OX=3981 GN=LACIC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000784	0.999197	CS pos: 15-16. Pr: 0.9560

TMHMM  Annotations     

There is no transmembrane helices in H257_02284-t26_1-p1.