CAZyme Information: H257_02250-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_02250-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		34002.40	6.5778

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913117:89475-90416(+)

Full Sequence      

METKGTEIAPNTTMVTPTTASPTTTPNNTVATPTTTPHTTVATPTTTPHTTVAPTTATPT
TTPHTTVTPTTATPTSKPNTTSVPTAVPVLTGLGHILPKHMFLDAFPNAHPLYTYENLLA
MATKYPEFASTGDVTADRREVATFLGHVALESGDLRFVEELKVSTMCQESPEYPCAPGKQ
YHGRGAIQLSWNYNYKDFGKVANIELVQFPELVATDPDLLWWSALWYSNDDRWNGNIHKV
VGRPGGFAYVTFMINGGLECGLNPSNKKSEATRIANYVKFCSMLGVDPGDNLSCQTAAYP
PKNLWIDPPTKRL

Enzyme Prediction     

EC	3.2.1.14:162

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	96	294	1.9e-54	0.9653679653679653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	3.80e-66	101	294	9	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	1.22e-46	99	294	12	232	Chitinase class I.
225720	COG3179	4.72e-04	178	258	113	187	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV63620.1|AA15|GH19	3.35e-115	91	309	334	552
AIG55513.1|CBM1|GH19	2.24e-97	92	311	20	237
ETV82190.1|AA15|GH19	2.62e-97	88	304	395	611
AIG56150.1|GH19	2.52e-96	88	311	12	222
AIG55723.1|CBM18|GH19	7.75e-55	91	295	140	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IJ4_A	3.88e-48	101	294	11	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	5.64e-48	101	294	12	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
2CJL_A	2.46e-42	96	294	2	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
4TX7_A	5.51e-42	99	298	19	242	Crystal structure of chitinase (GH19) from Vigna unguiculata [Vigna unguiculata subsp. sesquipedalis]
2DKV_A	1.02e-41	92	294	57	292	Crystal structure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group],3IWR_A Crystal structure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group],3IWR_B Crystal structure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06215|CHIT_PHAVU	1.99e-42	99	294	90	309	Endochitinase OS=Phaseolus vulgaris OX=3885 PE=1 SV=1
sp|P21226|CHI2_PEA	2.54e-42	111	294	93	301	Endochitinase A2 OS=Pisum sativum OX=3888 GN=CHI2 PE=1 SV=2
sp|P36361|CHI5_PHAVU	1.06e-41	99	294	89	308	Endochitinase CH5B OS=Phaseolus vulgaris OX=3885 PE=3 SV=1
sp|Q7DNA1|CHI2_ORYSJ	1.08e-40	92	294	88	323	Chitinase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht2 PE=1 SV=1
sp|Q41596|CHI1_THECC	2.05e-39	109	294	95	306	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000002

TMHMM  Annotations     

There is no transmembrane helices in H257_02250-t26_1-p1.