CAZyme Information: H257_01912-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_01912-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		65302.22	6.9356

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913116:986467-988206(-)

Full Sequence      

MLGRSATLHCLTILALVSTLWQHRVEGKGVCYDSFDYANMDAHFTTIKSRFDAVRTYQTQ
NTLLGLLWPNGTNTTVHVPDGPNSIDVAARHNLLIYAGVWIRSPFFEADLQAAIDGASRH
PASVKAILIGNEDLSNGLSLQTMVDTINEAKARIRATPGLEHIPVGTVQTDGDWIKYPSL
AAVCDVVGVNMYAFFDPYDFSTINNVIPHMNHRWQAMVSRFGKKALLTETGWPTDGGGPF
RNHQASIESAIKHFWDVQDWMDTNGGEHPMYFMFHDNPAKSTDIATLFENYFGLAYPSGA
WKFDVYNRPVPDPRWSLPFKIATSRDHVLRCDGGGLFKGPSDNANDRWSYDVNTHQVKCW
QQGTCLDGFWDSANRFTVHMYACNAANNNQKWIFSDLRLKHEIYTNRCLDADRSDIHVQV
WPCQANNNHQLFTIAGDMGHVSLVSIDRKRTLVAAAGTDRDGGERIAFAHGWFPSQGWVP
ADGQWTFLHDKNMVMSESRRKCLDAPHNANGSPIHLWPCNDSNGNQKWAYDATTKQLRHT
THKGFCLDMGSNNGYRPHLWECHAPNDAYVKFQQFNYAV

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	3.17e-16	405	575	10	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.31e-12	501	577	12	84	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	9.75e-12	361	528	9	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.09e-11	341	430	31	121	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	1.43e-11	492	577	2	82	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55595.1|CBM13|GH17	2.11e-136	17	579	7	560
AIG56197.1|CBM13|GH17	5.07e-135	11	579	12	551
AIG55519.1|CBM13|GH17	2.71e-129	25	579	15	553
AIG56230.1|CBM13|GH17	7.53e-107	15	579	5	508
AIG55518.1|CBM13|GH17	9.55e-96	14	576	6	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.89e-08	84	257	81	250	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.76e-07	84	257	81	250	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

H257_01912-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999794	CS pos: 27-28. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in H257_01912-t26_1-p1.