CAZyme Information: H257_01387-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_01387-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612		69575.61	6.7700

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913115:1418685-1420523(-)

Full Sequence      

MMLHQSRRDILPVSLPGNCDNDDTNDMAPLMLGINININIRPESSRSDWRKVGLGVVLAL
VGLASVGGITYGVWYYRREAMMMDPTLDTALLSDPLPYDRVPALWGDDFECLGWRATAGC
DPGGERTPQYDKTCDTAIGLGDAGFCEVRNRTSLQVYRVMATTCRGVIGLKTFTCNMAEE
FTDFSKQAATYVHDPAPQFSGVRRGIVFSVFKKALPGVFAIIKVLRSYGCTLPIEIFYRA
DELHAQSNVLVQALLQSDPNVVLREITDPHATKFRTKPYAVYHASFDQVLLLDCDNVPLR
DPTYLFDSPAFATHSAIFWPDLWHPSHTIFSVQAQNLLWQYVDMPFWDVFEQESGQVLVD
RRRAKDALHKLMAYTFGARQDGTLIESMEFLYGDKDLFRFAWRNTSTSYQYIQTPPAFAG
MYSWHRWISFCGLAMLQHDMDGEHLFLHRNQVKLTASPSQVPLFTHVLRFTGHDPHLYRA
ECKGRQDGYLCWGFQWPWVPATLDTIDWSEDGGGRADRKHVNIHQAEAMAVRFAIEAGAI
LGEVDADVPLTPLPLWRNWGVDVIVCSAVLLLWCLWQHVAQCWTPQKKTLFRSMFMSRKK
RKTSTLPGHEQH

Enzyme Prediction     

No EC number prediction in H257_01387-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	204	439	4e-46	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.35e-29	204	439	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	3.99e-06	215	341	13	166	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27901.1|GT71	2.19e-111	99	551	59	527
CCA25306.1|GT71	1.70e-101	60	483	17	475
CCA20955.1|GT71	3.48e-93	99	543	87	554
UIZ28362.1|GT71	1.15e-92	109	479	666	1050
AIG56191.1|GT71	3.06e-88	93	540	27	489

PDB Hits     

H257_01387-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	1.20e-10	222	323	264	378	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P38069|MNN2_YEAST	4.46e-10	122	439	97	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AD72|MNN24_CANAL	1.81e-08	222	376	311	495	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q59WF4|MNN2_CANAL	4.97e-08	219	376	202	357	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2
sp|Q5A687|MNN22_CANAL	1.97e-07	225	451	184	449	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999538	0.000482

TMHMM  Annotations     

Start	End
54	76