CAZyme Information: H257_01218-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_01218-t26_1-p1
• CAZy Family: AA15|GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1429		159409.83	6.0391

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913115:979216-985297(-)

Full Sequence      

MGLFKGCRSPRKVALQVHADDPHAPPATSGSTVLRDAADTSVTKKLVNDMDLFGEDSDAS
DDDAAIERYDRDDVSEDDEVYKSRNVDALLSKMTPEEMFVKFDEDHSGMISTDEFLKMLP
QLGIKLSDAKAIRIFDTCDKDGSGEIDMEEFKMAMFMVDPTTGNSLGFSPSSLLTPKDAF
HLFDSNGSGQLDELEFADALEYFGFSVTDAKQERLFLKYDTDKSGFIEYSEFRAMWLQCA
NIKHELVSRGVDVPKYATRKTHMQILEKALDEEERREDEAMDEAKWFHEWQLEKIRRRTL
AAKAALRAQDELAAALDAAGQVYVLGSGQHGQFNGDPAARDALVYDGYTHVSEIWQSRVL
PTYVPPDLKLKTSTIHPPSSLSSHEQPQRLVTPDYIQKRKEKLAEAKSAAAAAAAPAVPT
VEQNKLPMMRRRPENVTYDENRVSPPKLIRAAWHAKQTTDDRGGSTSRTEDDENKDDDAE
ESELELLNQKFLDDRAFIRSLRFKDIHPMTNTGWLWGRQVVQAAISDNVAYAVTASGQIY
CWGGQNKWWKGIEADDDDDATTVVDESEATRKEVERMRMLTSRSELIKMAAPRFVAEAVA
VEVEAQTKKLEDKRVRELAEDAQYEKHKRVVLYYDKWDPPPSYSTRIIYMHQVLLPKLDH
KNLHSSITARGVVCERATKQELVDLMGDLLLIEADMCTEEAQRGIKQMDFFIQDTNELRA
KKKTKSFEEIPEKAILLDSYLPLKRELERREAARKAQAIENKLNEARLKEDTFEACVARK
RVQLEDMCPEYTPRSTSTVIDLNGVTSRGPPLHPPRGSSAVWKIAAGESYACAVSQNGSL
YSWGVGISGRLGHGKSLEGIINADADHPSRVMALQSVFVKDVACAFDHSAAVSVDGHVYS
WGSASTGKLGVGLLDDSYEQFAMYPMLVPFPNRKRFRQVSCGRAHTGAVSTDGDLYMWGC
ANGGRLGLGERVQDMVVVPTLVVSLARVLVAQVSCGNSHSALTTEIRVDVDGNVETISGG
DVYVCGSSGPLMHFTPTWSIVSKLRGTPVRDVCCGFGHTAAVTLSGELYTWGQNTNECTG
HAADRRVIEAPELLRAFHVAPYNLAVGKRARQSSVYNQQDADLAVDGNRSGTLHTCMHTQ
YDDHPWWEVDLGQASVLERIKVWNRTDQPVDTSRRRDEFTSRLFPFWILVSEVPFDDSVG
SASLKAGRAQSNASAQFADNHRLTEWVLPSTGTVGRYIRIQVKGKRYLHLAQVDVFGVYN
AFNYVGHVSTVQCAKNVTLVVMRPLPSATSTHDHYLKAIQADPDNATILRQYDAYAKCFQ
LYGRGEALTHEKCRLCRAIRQCEVCEFYTSTPSSDLPLTTLGEKLGLAEATDVILSREPP
RLTFDKRASTPAVVSESITHKFAKVFTLSPKKLGLPFKLSPSKKDPPRS

Enzyme Prediction     

No EC number prediction in H257_01218-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	1111	1253	6e-24	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227511	ATS1	2.19e-26	810	1116	93	414	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227511	ATS1	4.30e-26	781	1095	138	440	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227455	FRQ1	3.04e-19	83	237	3	155	Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms].
227511	ATS1	5.12e-18	820	1011	285	471	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
238008	EFh	2.30e-16	96	155	3	62	EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKJ27495.1|AA5|CBM47	6.28e-18	1101	1257	724	870
QTD39109.1|CBM47	2.62e-17	1103	1259	1352	1495
QOX79078.1|CBM47	5.93e-16	1103	1257	131	272
ACD95713.1|CBM47	1.37e-15	1103	1257	131	272
ABD82964.1|CBM32|CBM47	1.39e-15	1103	1255	157	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4DNV_A	1.06e-32	824	1074	61	292	Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_B Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_C Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_D Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4NC4_A	1.22e-32	824	1074	60	291	Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana],4NC4_B Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana],4NC4_C Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana],4NC4_D Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana]
4DNW_A	5.17e-32	824	1074	61	292	Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNW_B Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4NAA_A	5.48e-32	824	1074	60	291	Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_B Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_C Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_D Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NBM_A Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_B Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_C Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_D Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],6DD7_A Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_B Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_C Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_D Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana]
4D9S_A	9.42e-32	824	1074	73	304	Crystal structure of Arabidopsis thaliana UVR8 (UV Resistance locus 8) [Arabidopsis thaliana],4D9S_B Crystal structure of Arabidopsis thaliana UVR8 (UV Resistance locus 8) [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FN03|UVR8_ARATH	8.63e-31	824	1074	72	303	Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
sp|Q9VR91|HERC2_DROME	1.13e-29	824	1128	3024	3317	Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster OX=7227 GN=HERC2 PE=1 SV=3
sp|Q4U2R1|HERC2_MOUSE	7.32e-27	802	1134	2976	3298	E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
sp|O95714|HERC2_HUMAN	1.26e-26	802	1134	2975	3297	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
sp|Q8IVU3|HERC6_HUMAN	1.80e-23	823	1082	27	271	Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000006

TMHMM  Annotations     

There is no transmembrane helices in H257_01218-t26_1-p1.