CAZyme Information: H257_01016-t26_7-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_01016-t26_7-p1
• CAZy Family: AA15
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		66904.92	6.7121

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913115:254342-257119(-)

Full Sequence      

MYLESSTSPSTPGAMPPSASPTSVSMERGITQVRVQPKSTYYQERVVRGVEWNVGPVAAA
ALSSNKTINSSGRTNFIKQIIFTFVLVCVVTYVLGEHIAAIGLPTAAAAAPFQSAATSTS
AVYVSMVSIPIMERVLPLKHLAEELLHRGYRVSIAMPEICRSWVSDVPGLEFISLGTMSV
PSHALTIKTAIGHVGVYASYRTSLQHYASFHQPMLHPLVEDFTEDPPSLIVVDRYTFAGM
DVAASLGIPFVINNPFLLLDIDDPPAYVPAPLSHHPSMEVMTVFQRCMNGYFRLRFRLLN
LDLISSSVNPRTSSHANTVVVTNTVFGLEYPRPLTPLHRMVGALRRHTTAPLDADLASWF
DISPQNHDDDAADAAGPFQVVYVDFGPDVWVSIEVVTQIITVLRQLDLRVVWKLTADLHK
AWSTADDGAPWHALESWEVYFSPLVAHTAVLQRAAFFVTAGGFHHVQEALCVGRPVLGIP
FSAEQAEFVDRVTRAGAGVSIEATELTIDNFRHAAHLLLTHDRFAKAATRLGGLLTSAGG
VSEAANVVLAVADRGASALIPAHHTQPVVKTFLLDVYAVYGAVLCGVAVILRTLLSALFS
VFQRKSMPDVPKLSTE

Enzyme Prediction     

No EC number prediction in H257_01016-t26_7-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	218	551	4.2e-20	0.774869109947644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.81e-32	135	548	14	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.85e-21	127	557	7	404	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	1.91e-10	242	590	134	480	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23525.1|GT1	1.28e-105	113	603	88	592
UIZ21193.1|GT1	1.12e-45	123	592	89	599
CCA14547.1|GT1	1.73e-34	127	598	69	541
QSV56128.1|GT1	4.98e-29	124	548	5	417
APR82782.1|GT1	5.36e-29	137	548	3	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DU2_A	4.80e-07	417	554	266	417	Structural analysis of EspG2 glycosyltransferase [Actinomadura verrucosospora],5DU2_B Structural analysis of EspG2 glycosyltransferase [Actinomadura verrucosospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q28612|UD14_RABIT	1.63e-13	136	534	41	446	UDP-glucuronosyltransferase 1A4 OS=Oryctolagus cuniculus OX=9986 GN=Ugt1a4 PE=2 SV=1
sp|Q64634|UD18_RAT	1.15e-12	141	534	44	443	UDP-glucuronosyltransferase 1A8 OS=Rattus norvegicus OX=10116 GN=Ugt1a8 PE=2 SV=1
sp|Q6ZQM8|UD17_MOUSE	2.02e-12	143	534	46	444	UDP-glucuronosyltransferase 1A7 OS=Mus musculus OX=10090 GN=Ugt1a7 PE=1 SV=1
sp|Q9HAW7|UD17_HUMAN	6.18e-12	218	534	133	443	UDP-glucuronosyltransferase 1A7 OS=Homo sapiens OX=9606 GN=UGT1A7 PE=1 SV=2
sp|Q64638|UD15_RAT	6.19e-12	218	534	134	444	UDP-glucuronosyltransferase 1A5 OS=Rattus norvegicus OX=10116 GN=Ugt1a5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

Start	End
80	102
580	602