CAZyme Information: H257_01016-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_01016-t26_1-p1
• CAZy Family: AA15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	KI913115|CGC2	68525.82	6.8879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913115:254342-257161(-)

Full Sequence      

MTPAARYHPPWRVGMYLESSTSPSTPGAMPPSASPTSVSMERGITQVRVQPKSTYYQERV
VRGVEWNVGPVAAAALSSNKTINSSGRTNFIKQIIFTFVLVCVVTYVLGEHIAAIGLPTA
AAAAPFQSAATSTSAVYVSMVSIPIMERVLPLKHLAEELLHRGYRVSIAMPEICRSWVSD
VPGLEFISLGTMSVPSHALTIKTAIGHVGVYASYRTSLQHYASFHQPMLHPLVEDFTEDP
PSLIVVDRYTFAGMDVAASLGIPFVINNPFLLLDIDDPPAYVPAPLSHHPSMEVMTVFQR
CMNGYFRLRFRLLNLDLISSSVNPRTSSHANTVVVTNTVFGLEYPRPLTPLHRMVGALRR
HTTAPLDADLASWFDISPQNHDDDAADAAGPFQVVYVDFGPDVWVSIEVVTQIITVLRQL
DLRVVWKLTADLHKAWSTADDGAPWHALESWEVYFSPLVAHTAVLQRAAFFVTAGGFHHV
QEALCVGRPVLGIPFSAEQAEFVDRVTRAGAGVSIEATELTIDNFRHAAHLLLTHDRFAK
AATRLGGLLTSAGGVSEAANVVLAVADRGASALIPAHHTQPVVKTFLLDVYAVYGAVLCG
VAVILRTLLSALFSVFQRKSMPDVPKLSTE

Enzyme Prediction     

No EC number prediction in H257_01016-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	233	565	3e-20	0.7722513089005235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.62e-32	149	562	14	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	8.42e-21	141	571	7	404	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	2.44e-10	256	604	134	480	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23525.1|GT1	1.91e-105	127	617	88	592
UIZ21193.1|GT1	1.37e-45	137	606	89	599
CCA14547.1|GT1	1.97e-34	141	612	69	541
QSV56128.1|GT1	5.42e-29	138	562	5	417
APR82782.1|GT1	5.83e-29	151	562	3	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DU2_A	4.96e-07	431	568	266	417	Structural analysis of EspG2 glycosyltransferase [Actinomadura verrucosospora],5DU2_B Structural analysis of EspG2 glycosyltransferase [Actinomadura verrucosospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q28612|UD14_RABIT	1.70e-13	150	548	41	446	UDP-glucuronosyltransferase 1A4 OS=Oryctolagus cuniculus OX=9986 GN=Ugt1a4 PE=2 SV=1
sp|Q64634|UD18_RAT	1.20e-12	155	548	44	443	UDP-glucuronosyltransferase 1A8 OS=Rattus norvegicus OX=10116 GN=Ugt1a8 PE=2 SV=1
sp|Q6ZQM8|UD17_MOUSE	2.11e-12	157	548	46	444	UDP-glucuronosyltransferase 1A7 OS=Mus musculus OX=10090 GN=Ugt1a7 PE=1 SV=1
sp|Q9HAW7|UD17_HUMAN	6.43e-12	232	548	133	443	UDP-glucuronosyltransferase 1A7 OS=Homo sapiens OX=9606 GN=UGT1A7 PE=1 SV=2
sp|Q64638|UD15_RAT	6.45e-12	232	548	134	444	UDP-glucuronosyltransferase 1A5 OS=Rattus norvegicus OX=10116 GN=Ugt1a5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

Start	End
94	116
594	616