CAZyme Information: H257_00680-t26_2-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_00680-t26_2-p1
• CAZy Family: AA15
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712		79758.48	8.7965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913114:1967624-1970191(-)

Full Sequence      

MQLLTPSKQVTKTTTCICPAHVKTKLLVRSKSSQKSTTTVMLGGQRTAEKTTMSYVTFNG
DLTPRAKQQLTTTELIKRAEKLDYYLQLAYGYAKQIEDMAPIATVSSPLVQHAWECRRHV
APPPFRASPEFTHMQYTAVRTQDPINFSRDGYVLRVKECGNDVKVFVTITMYNEPASQLE
STLVGLAKGIAYMCEQHGYDYWQHVVISIVADGRSKINPSMLTYLSTLGCFDKPTMVQMS
MGIAAEVHLFEATVQMPTATDGLFYPPMQVIFALKEANNGKLHSHLWFFNAFCEQLAPKY
TVLVDVGTIPAETSVYRLIRSMERNAQIGGVAGEIAVDRPQFFNPVIAAQHFEYKIANIM
DASLQSVFGFIGVLPGAFSAYRYQAIRAIDGEGPLVEYFKSLTASKKELGLFVGNMYLAE
DRILCFEILARRDCNWTMHYVKDAIASTDVPETLVDLIKQRRRWLNGSFFAGLFAIWNFG
RVWRDTSHSFARKCIFTLQFTYMAVLNVLNWFLLSNLFLAFYYILSLALFYRSPVLLRVT
LTMYFVLVGSLIVFALGNKPGRRTAGFYKVSSYIMGFIMLGATAISLFALTGQVHFMDIR
PDLVSCSVADWELPAGAVSSIGLVFLSAFSHGEFSILASTIQYYFMLPTFINILGIYAYS
NLHDLSWGTKGIDSSHHSGGHTGGTSIKHMVALQLNTANLDVTMEADKQKVR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	171	322	2.6e-45	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	3.50e-76	167	471	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	3.43e-55	171	322	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	1.48e-27	164	594	55	411	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	6.76e-16	270	391	55	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
367353	Chitin_synth_2	1.22e-15	300	466	204	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA49151.2|GT2	0.0	7	710	6	702
ADE62521.1|GT2	2.06e-261	74	694	197	822
AAC49743.1|GT2|2.4.1.16	1.38e-229	69	694	144	760
ADE62520.1|GT2	5.36e-156	66	676	145	753
ACA96933.2|GT2	3.51e-140	130	687	128	698

PDB Hits     

H257_00680-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	2.45e-230	69	694	144	760	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P87073|CHS1_PHYB8	1.83e-117	124	671	128	704	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|J9VGT6|CHS8_CRYNH	2.08e-117	124	673	332	903	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2
sp|Q99127|CHS4_USTMA	9.66e-116	126	702	245	844	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2
sp|P30597|CHS1_SCHPO	1.60e-115	124	671	148	724	Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chs1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

Start	End
607	629
636	658
464	483
503	525
535	557
570	592