CAZyme Information: H257_00053-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_00053-t26_1-p1
• CAZy Family: AA15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
881	KI913114|CGC5	97918.54	6.8074

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913114:134918-140477(-)

Full Sequence      

MLLVSTWFWWSCWWWAGLHRQADAVSIGGSVESTLASFHHPFLEILTPVNGQVAETTEVD
IELVVREITMPSSFRGTKICLGIHAKNAVPTSNGDTETGLTEFCFDQTSSKVFHAQNLVA
GMSYTVRVFLVDRGNVIAVSMRHFRVAAIAIPGHAGLVTILTALQHAVTLHDTDAAVGIY
RRILVESPEHSHTLHLLGLTKLRAGRAMEAIPYLQQALRANATIEALHNTLGLCLKEVGR
SADAAWHFEKALALRPSYVEARFNLGTLWQATQVYDRAIDEFRTLAAMVQANSLDLTVAH
QRDVFVRLCGAYQGASRRDDALGCLNDALALWPHDTDFINERGNWYLNAGYLDLAHDDYQ
VAADAGALVATFNLALVKEAMGHTNDSINVYANLLQLTETRHLSTSHIRMVQAGVVPRVL
PFDSALVDQARQDMGRRLDAMLQQDSITTVDWTDLMTNQFPTGYHLISHPHNNNQLKQKL
ATMLEMYAPSLKTPSFLGRSYSTIPRELRHRSRIGFVAEDSHVLDLVHALDQSSFDVFLF
TVSSSAAANVARQLGLRHVHFVALPAGVGPSAVEIQRHDLDVLIYADVGANKWSYFLSFA
KLAPVQAAWALGYSDTSGVRAIDYVVTSEYEYPDFDRQHYSETPFALKGLGLYQTQSMAP
NTTTYPLTSRAHIRQLLVQEFHLPKSFHFYFVAEPVDHLHVDMDAVVRRILKRDPLGHMF
FLASLSHWNAAFADRMTLQPGLPIDRVHLIDSSEVPVAALLRACDVHLANLYTNTFQHTL
EAVAAGVPTVTLPGQLWRTRVPFGVLRHINAVATVATSAADYVRLAVRAAGDQPFRDAVV
ATLHSNGPKLFGDDTAVIEWTRFLHFALDQARRVRQETPVM

Enzyme Prediction     

No EC number prediction in H257_00053-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	309	846	2.3e-49	0.5092198581560283

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.27e-14	418	843	167	588	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	4.10e-13	193	283	3	93	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
411346	social_mot_Tgl	9.17e-11	197	279	37	120	social motility TPR repeat lipoprotein Tgl. Social motility in delta-proteobacterial species such as Myxococcus xanthus depends on a type VI pilus, which in turn depends on assembly of the PilQ secretin complex. Tgl, a tetratricopeptide repeat (TPR) outer membrane lipoprotein, is required for PilQ assembly.
276809	TPR	1.95e-09	170	253	14	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	2.31e-09	175	396	313	527	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20641.1|GT41	1.09e-76	38	867	33	903
BAI76932.1|GT41	4.26e-35	228	879	34	658
QTA91146.1|GT41	2.78e-34	562	872	568	868
AMS33413.1|GT41	1.46e-33	361	873	271	769
QTA90106.1|GT41	1.47e-33	526	868	403	731

PDB Hits     

H257_00053-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

H257_00053-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.711516	0.288488

TMHMM  Annotations     

There is no transmembrane helices in H257_00053-t26_1-p1.