CAZyme Information: GLOIN_2v979944-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v979944-t44_1-p1
• CAZy Family: PL38
• CAZyme Description: carbohydrate-binding module family 21 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494		55210.63	7.6970

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000060:469153-470712(-)

Full Sequence      

MPYTPPTTSPALSPSTPCKGWPFSTISSIGSKKKNFDLDKFANDFVKDIDRDNAIKEVKD
ILSTSPQLSTSPRRKSAPESYSRKPSLKVNLPTLPLPEIRPCILRKKSGEIVKPSLKKGL
SKSEPVTPTFPKYVHFNADLEQIRLFNEAQRPQAVSADVSSDEESDDDNVFDDNILGYSA
SDDEDDNIEEPELIISLPNRPVITTLHSSKPVFVESIYLSQDKRKLQGRIMVQNIAFQKT
VDVRYTFDFWSTVSEVRATFVEGITSKDNKNSFDAFIFSIELIDNSRNPIDGKTMYFAVH
YSVENNDFWDNNNGSNYQVNFKRITPPSSTIFSNNKKSKNNQNTSSNSSKWSMASMSRQS
TKNLNESLCRSPPTLESSPKLNMDDVRKRVMGRYDIGVSLSVAQNSRSSAPVTPTNDYSR
TFQFFAPQVQYGTSDFPISHSQLNNSNPIAIPSPSKPDIGSSSYYDLVNQYCFYSGSPYA
TNSPLTAGSPPVLI

Enzyme Prediction     

No EC number prediction in GLOIN_2v979944-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	209	319	7.4e-30	0.9813084112149533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	1.07e-38	209	320	4	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	2.83e-10	234	319	5	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX97277.1|CBM21	1.20e-42	99	492	219	632
CAP80870.1|CBM21	2.10e-42	100	482	222	629
QRD04062.1|CBM21	2.15e-42	99	484	207	612
QRD04063.1|CBM21	2.43e-42	99	484	224	629
ACP93043.1|CBM21	4.81e-42	97	327	51	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	1.91e-11	224	319	46	135	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]
2M83_A	2.50e-09	214	319	34	133	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40036|GIP2_YEAST	1.26e-11	224	319	437	533	GLC7-interacting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIP2 PE=1 SV=1
sp|A6QNP3|PPR3B_BOVIN	3.85e-10	224	319	142	231	Protein phosphatase 1 regulatory subunit 3B OS=Bos taurus OX=9913 GN=PPP1R3B PE=2 SV=1
sp|Q6IN01|PPR3B_RAT	3.85e-10	79	319	19	231	Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
sp|Q7TMB3|PPR3C_MOUSE	5.11e-10	220	319	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q86XI6|PPR3B_HUMAN	7.00e-10	224	319	143	232	Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GLOIN_2v979944-t44_1-p1.