CAZyme Information: GLOIN_2v1883683-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1883683-t44_1-p1
• CAZy Family: GT76
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		62121.68	8.9856

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000348:53567-55552(+)

Full Sequence      

MIKRNSILLLILLLNLVFYVNVNTATTQNYILRKDDFDRSGIPKNILVGSYIGGRSHVKP
ILDVVAILIERGYNVTLLTAGRYEPSSEYPGLNQITLGLSEVNGNNMKNFKNNVEFDYKG
LPQILEPSTNDYKKTYEKYKKTAKEYNIDLFICDVLANEACIDAANNLKKPVVGWTSFLQ
FMDPVPYKDDPVYGCNTSLENESFFERFRCALIQPLQVASKLGPFAHQLNDIRKQMNIEP
SGKIPKVSLSLVDTFFGFELPQPLAPNVQEVGPVLPEEYPPITPELSNFINAHERVLYIA
FGTRFFTCTENNNKILQSLVEAINKKIVDGVVWPLGQTSRDNFYPTLNLTDGTQVQTLSI
LNNKHPHIHITNFAPQFAVLNHTNTKLFFSHGGAGSAHESLYTGTPMLVLPLGGDQMGNA
QKLKTAGVALTLSVYNLNVNDILNKMSKLLEDEKIKKNLKRMEVLTKINSKRKYRAADLI
EYILHSSGLEEYINDDYLKEWAPAASRMGFIKANNLDVYGALLGIVLTLIGGIVFKLFKS
ISNPSSIRIKSKKA

Enzyme Prediction     

No EC number prediction in GLOIN_2v1883683-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	260	462	4.4e-30	0.4397905759162304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.41e-45	45	483	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	2.88e-27	246	534	225	482	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	7.85e-23	46	481	4	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	5.18e-21	246	461	245	441	ecdysteroid UDP-glucosyltransferase; Provisional
177813	PLN02152	9.21e-08	245	424	198	385	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	6.07e-55	13	553	10	544
QKD47039.1|GT1	2.35e-53	44	519	9	502
QPC75432.1|GT1	6.24e-52	44	519	10	503
QGI59140.1|GT1	1.63e-51	44	519	9	502
QGI90050.1|GT1	1.63e-51	44	519	9	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	3.36e-13	272	462	19	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	1.26e-12	281	459	7	162	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	1.60e-11	281	462	6	164	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
2IYF_A	2.56e-09	367	481	284	395	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
4M83_A	2.56e-09	367	481	284	395	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q64633|UD17_RAT	2.10e-22	247	540	249	507	UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1
sp|Q6ZQM8|UD17_MOUSE	5.01e-22	247	539	249	506	UDP-glucuronosyltransferase 1A7 OS=Mus musculus OX=10090 GN=Ugt1a7 PE=1 SV=1
sp|Q9GLD9|UDB33_MACMU	8.84e-22	225	530	222	505	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|Q9TSL6|UDB23_MACFA	2.10e-21	225	530	222	505	UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis OX=9541 GN=UGT2B23 PE=1 SV=1
sp|P19224|UD16_HUMAN	3.80e-21	177	536	181	507	UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999661	CS pos: 24-25. Pr: 0.9701

TMHMM  Annotations     

Start	End
7	29
516	538