CAZyme Information: GLOIN_2v1834746-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1834746-t44_1-p1
• CAZy Family: GT39
• CAZyme Description: glycosyltransferase family 34 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500		57958.81	6.3918

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000008:209127-210779(-)

Full Sequence      

MTCPHYKIALFIFSQMEQVDKRMLMREELFGITDNLIPCMKQDTTEIFYRFLANKSKKID
MSILHSYTAEKMEFNDIIEIDIQHSDDLHHYLLENAKSLQEECTTFDHLVIIDTFTMINL
EKIKNKISTSTLVTDTQKLVWGSFNSNRTENMAVIIGASAIQPILDNLKFKLNHTSILSS
LYLYHKKYPNKKIPSDLIFINDPISIIEWPNTITSIECADCVVAIGHIYQDVEIKQIKNE
LNIPTTLPCNARSDLKMYSKETASKFRPNVAVVTSSFLYKDNCMLEAGFLSAKNKREYAE
MHGYAFVSRSAEFAQQLYHDRKPVWGKIDAIEKLLPYYEWLIWLDMDAIFVNRSLTVERF
LEMCEEKVGGKEEFEKINIIVARPINDKMINAGVFLIKNSAWTRDLLRRGIQPRYDFSYT
GSLEQEAMRDAIRHPYWRKNVLNLEYDDHSLNTFPDRYVRGDFIVHYAPIGGCPAAPVLR
GLSNVKVLEEFPNAEISIPF

Enzyme Prediction     

No EC number prediction in GLOIN_2v1834746-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	291	468	2.2e-20	0.8455284552845529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.68e-20	268	473	3	232	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	2.93e-09	267	407	126	262	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	1.91e-07	293	407	155	263	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09137.1|GT34	6.03e-84	2	489	118	646
CDS05704.1|GT34	4.21e-81	17	490	153	685
CAG4711197.1|GT34	6.20e-20	265	474	7	206
BBN05257.1|GT34	8.41e-16	290	468	136	330
ACO66271.1|GT34	1.37e-12	291	491	215	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	4.70e-06	291	407	59	169	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	7.45e-12	293	473	129	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.32e-10	293	473	129	333	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P50108|MNN10_YEAST	4.50e-10	290	455	148	333	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	1.51e-08	290	407	101	238	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|Q9SZG1|GT6_ARATH	5.66e-06	293	432	133	269	Glycosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=GT6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GLOIN_2v1834746-t44_1-p1.