CAZyme Information: GLOIN_2v1777518-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1777518-t44_1-p1
• CAZy Family: GT28
• CAZyme Description: glycosyltransferase family 34 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		66515.63	5.7330

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000142:20758-22671(+)

Full Sequence      

MEGQSNYFLDCAKYQFRKIKLLPLLIAIFVIFLFAIPYYTKYNENDNPPLVDLEGNAPPL
SDDDDNIQNSKCPNYKMVLFISSEMENIEKRMLMREELFGITDNLVPCMKQDTSKIFYKF
LIKKKKPLDDEAFRNFLSEKMEYNDIEEITPKVGEDWEQLMLKYAQLLQESCITFDHLIL
IDVYTMINLEKLQDKISSLSIANQTISNTNKMVWGSFNTNLTDNMATILGSSAIKPILNH
SNHPSKNYTSIISRFYYHHLNHPNEKIPDDLILINDPLSIVEWPNSIKSIPCVDCIIAIG
HIYQDWEVRKIKDKLKISTIIPCKVRSDIEMYSKNTSKLRSNIVVMTSSFLYSDNCMLEA
APLSAQNKRDYAEKHGYAFVSRSTEFVQQLLRKRKEVWGKIDAVEKVLPYYEWLIWLDMD
AIFVNRTLSIEDLLKMSEEKVGGKKEFEKINFIVARPIGDDMINAGVFLIRNSDWARDFI
RNGIQARRDRAYRGMKEQQAMRDAIKQPNWKPNVLYLNGDDHTINTFPDRYVRGDYIVHY
APEEGCPADPVLGGLKKVAMLEESPDDEIILPF

Enzyme Prediction     

No EC number prediction in GLOIN_2v1777518-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	355	528	3.1e-23	0.7723577235772358

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	6.73e-22	341	546	3	232	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	9.61e-07	364	479	152	261	xyloglucan 6-xylosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09137.1|GT34	8.66e-84	74	562	121	646
CDS05704.1|GT34	6.76e-77	86	563	153	685
CAG4711197.1|GT34	2.39e-18	338	547	7	206
CCO17994.1|GT34	5.63e-12	364	545	483	663
ACO66271.1|GT34	9.96e-12	364	545	215	395

PDB Hits     

GLOIN_2v1777518-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	5.34e-12	330	546	91	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|P78817|YFE6_SCHPO	5.98e-10	359	475	97	233	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|P50108|MNN10_YEAST	2.36e-09	363	528	148	333	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|Q09174|GMA12_SCHPO	9.08e-09	343	546	105	333	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|A2ZF66|GT6_ORYSI	4.36e-06	366	480	178	286	Probable glycosyltransferase 6 OS=Oryza sativa subsp. indica OX=39946 GN=GT6 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000003

TMHMM  Annotations     

Start	End
21	40