CAZyme Information: GLOIN_2v1774161-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1774161-t44_1-p1
• CAZy Family: GT22
• CAZyme Description: glycosyltransferase family 49 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		48154.05	8.3295

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000100:373486-375007(+)

Full Sequence      

MAFSILFSITQLVKYTFGNYGIYSSEFLENQPIFRTYDTHRNSPLSEMTNKHRFSKIHAY
SPHTLVDSIHPYYIRAESKFKPDDVTVITFVTHNRLNELVRLAELWKGPISATLHIPSKI
GLTDPLIVETINSIKKIYKKKTNLRKQIDIHLITGPSTSLNETLLPTPTNFHVNVARFFA
RTEFIFFLDFDTWPTPETHSNIKRYADILIKNNVLILPTFVFIENVEHVENSTIHYKFPK
TKNDVIRLVNRRKLGLQDYGWEINSGPTCLDSWLKADELFHVEEYELHYRPNFVARKGGQ
IPWCSERFDDNKAACIFEIYLSGAELYVDPNSFLIRHHFDQDSHLVNYGDPHWQKVINSR
MYTNFSREVCLLYVRTFVAMDLWKSPISDHVKQECQRVLASWGSGLIKNSEK

Enzyme Prediction     

No EC number prediction in GLOIN_2v1774161-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	77	374	1.8e-26	0.8367952522255193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.06e-20	84	373	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11928.1|GT49	5.45e-67	3	411	116	510
CDS07474.1|GT49	1.30e-63	1	411	130	525
CDS14416.1|GT49	3.08e-61	21	401	102	484
CDS06192.1|GT49	4.28e-57	38	401	124	477
CDS06217.1|GT49	7.56e-56	71	398	113	424

PDB Hits     

GLOIN_2v1774161-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q21389|LGE1_CAEEL	2.20e-14	81	359	349	613	Glycosyltransferase-like protein LARGE OS=Caenorhabditis elegans OX=6239 GN=lge-1 PE=3 SV=3
sp|Q54PG8|GNT14_DICDI	1.53e-10	85	390	348	633	Glycosyltransferase-like protein gnt14 OS=Dictyostelium discoideum OX=44689 GN=gnt14 PE=2 SV=1
sp|Q32NJ7|LRG2B_XENLA	2.16e-10	82	336	438	672	Xylosyl- and glucuronyltransferase LARGE2s OS=Xenopus laevis OX=8355 GN=large2-b PE=2 SV=1
sp|Q66PG1|LARG2_DANRE	2.92e-10	65	336	446	699	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1
sp|Q66PG4|LARG2_CHICK	3.67e-09	82	336	454	688	Xylosyl- and glucuronyltransferase LARGE2s OS=Gallus gallus OX=9031 GN=LARGE2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997677	0.002358

TMHMM  Annotations     

There is no transmembrane helices in GLOIN_2v1774161-t44_1-p1.