CAZyme Information: GLOIN_2v1743889-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1743889-t44_1-p1
• CAZy Family: GT2
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		66862.58	8.9720

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000003:635052-637261(+)

Full Sequence      

MKYYLRLFSKKLFLFIIICNSIFNIVNGTEFKQYAVPPADGWVPSEMILDRTEIPKNILL
GVTIGGWNHLRHILTIANILADRGYNLTLAKRGKFLQSEQYPKINFISLGEEIDLSKDPE
TIQLVKEKVDVGRFKKVFKNHYAAYDSIFLRLKEISEMIKPDLFFCDTVNNEPCFDVAWL
MKKPLVGISTSPLGLTHTPYRSDPIFGCKVNMENESFWERFRCEFISPLQFLWSFKSSFD
NFNKVRAGYGLPSLKSPFERWQNSLFLVDNFFGYETPVPLPPLYQEIGPVLPDYFPSLTP
DIEKFLNSHKRTMFVALGSFLFLSSENYAKLLQSIIEVIENNIVDGVIWANIEKYRESFP
SNITLSDGRTISTSNLFDNKNSNIFMTSFAPQFSILNHTNTKIFLSHSGSGSVYESLYAG
TPLLSLPITYDQPGNAEKLELAGVALTLDKTNLEVKDILNKIEKILNDEQIRINTKRLKT
LAMINSKRKYRAADLIEFTLYSSVLKQKNINDENYNIEKWLFKELITPDTRMGLIRGKYL
DVYAAALIIVISITFLSIFIIRKLIYIKLFKVKEGDKDKKD

Enzyme Prediction     

No EC number prediction in GLOIN_2v1743889-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	219	482	6.2e-28	0.5602094240837696

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.15e-39	57	497	2	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.08e-23	60	497	5	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	6.66e-17	264	481	227	421	UDP-glucoronosyl and UDP-glucosyl transferase.
273616	MGT	1.12e-16	360	497	254	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	6.12e-16	279	485	262	447	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	2.89e-57	53	536	35	529
QKD56593.1|GT1	3.46e-56	55	547	7	504
QPC75432.1|GT1	1.53e-53	53	547	7	507
QGI59140.1|GT1	5.53e-53	50	547	3	506
QGI90050.1|GT1	5.53e-53	50	547	3	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	3.10e-14	382	478	90	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	4.53e-14	382	468	69	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	4.26e-13	383	478	69	164	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
6PNT_A	9.07e-09	360	478	299	411	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
2IYF_A	1.42e-07	363	512	265	410	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q64435|UD16_MOUSE	1.66e-16	68	481	37	444	UDP-glucuronosyltransferase 1-6 OS=Mus musculus OX=10090 GN=Ugt1a6 PE=1 SV=1
sp|Q3SY77|UD3A2_HUMAN	1.17e-15	58	470	25	432	UDP-glucuronosyltransferase 3A2 OS=Homo sapiens OX=9606 GN=UGT3A2 PE=2 SV=1
sp|P08430|UD16_RAT	6.49e-15	68	481	36	442	UDP-glucuronosyltransferase 1-6 OS=Rattus norvegicus OX=10116 GN=Ugt1a6 PE=1 SV=1
sp|P06133|UD2B4_HUMAN	8.58e-15	265	478	255	445	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q1LZI1|UD3A1_BOVIN	1.12e-14	59	470	25	432	UDP-glucuronosyltransferase 3A1 OS=Bos taurus OX=9913 GN=UGT3A1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.154965	0.844993	CS pos: 28-29. Pr: 0.7950

TMHMM  Annotations     

Start	End
12	29
539	561