CAZyme Information: GLOIN_2v1739402-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1739402-t44_1-p1
• CAZy Family: GT2
• CAZyme Description: multicopper oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		55341.71	6.2875

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000721:8996-11385(+)

Full Sequence      

MIFYKLFVHLFCVIFWATLVLSKPILNQELIKSRNYEPKKNIFDITLKRVTLAPDGFTRS
LATINGQYPGPTIEVKKGDRIVINVRNELGEPTSIHSHGMFQRGTPWFDGVAGQSQCLIP
DNYAFTYDFTVPDQAGTYWYHSHAMTQYVDGVVGALIIHDPDDPYLNEYDEEIIVMLTDY
HHTESEILLKKFLTPSSGGDEPVPDNGLINGKNNFDCSKAPHGSKCVDNSGLAKFEFVSN
KRYRLRIINTSAFSAFFFSIDKHEMEVIEVEGSYTKRNKIHRLPINVAQRYSVIVTANQP
VDNYIMRSEFQKTCMPDDAKKLSIVKAIVHYDGAPEDSAPKDVPWKDFLEECIDLKHETL
QPLCEENLPKATKKMELTITFHNDSSGVVRAFLNESSYEPDIKFPTLSRIFAGKANNFPR
DRNAYIFDTPGEVVDITFINTDEGDHPFHMHGHQFWVLGFGNGTHVDKKSLNTVNPIKRD
TSTIPASG

Enzyme Prediction     

No EC number prediction in GLOIN_2v1739402-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	57	487	2.6e-101	0.8966480446927374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	3.18e-75	53	484	14	485	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
215324	PLN02604	7.90e-62	1	481	2	505	oxidoreductase
259926	CuRO_1_Diphenol_Ox	9.24e-62	43	159	3	119	The first cupredoxin domain of fungal laccase, diphenol oxidase. Diphenol oxidase belongs to the laccase family. It catalyzes the initial steps in melanin biosynthesis from diphenols. Melanin is one of the virulence factors of infectious fungi. In the pathogenesis of C. neoformans, melanin pigments have been shown to protect the fungal cells from oxidative and microbicidal activities of host defense systems. Laccase is a blue multicopper oxidase (MCO) which catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
177843	PLN02191	9.49e-61	54	484	37	508	L-ascorbate oxidase
225043	SufI	1.05e-60	55	461	48	394	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX53525.1|AA1	8.25e-102	35	488	101	576
AUS45844.1|AA1	4.22e-99	54	480	136	586
QBZ62742.1|AA1	1.53e-93	38	484	184	666
AEO70365.1|AA1	2.66e-93	35	484	106	602
QDS68826.1|AA1	8.04e-92	38	488	114	596

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3KW7_A	5.80e-70	42	481	5	430	Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2],3KW7_B Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2]
5NQ7_A	4.83e-68	42	480	26	445	Crystal structure of laccases from Pycnoporus sanguineus, izoform I [Trametes sanguinea]
5NQ8_A	9.46e-68	42	480	26	445	Crystal structure of laccases from Pycnoporus sanguineus, izoform II [Trametes coccinea],5NQ9_A Crystal structure of laccases from Pycnoporus sanguineus, izoform II, monoclinic [Trametes sanguinea],5NQ9_C Crystal structure of laccases from Pycnoporus sanguineus, izoform II, monoclinic [Trametes sanguinea]
5EHF_A	1.59e-67	42	488	5	432	Laccase from Antrodiella faginea [Antrodiella faginea]
2XYB_A	1.68e-66	42	480	5	424	CRYSTAL STRUCTURE OF A FULLY FUNCTIONAL LACCASE FROM THE LIGNINOLYTIC FUNGUS PYCNOPORUS CINNABARINUS [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1RMG9|FET3_GIBZE	2.46e-73	43	488	27	462	Iron transport multicopper oxidase FET3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FET3 PE=2 SV=1
sp|Q02081|LAC4_THACU	1.37e-71	34	488	23	463	Laccase-4 OS=Thanatephorus cucumeris OX=107832 GN=LCC4 PE=1 SV=1
sp|K7NCS2|FETC_EPIFE	2.07e-69	43	488	27	461	Iron transport multicopper oxidase fetC OS=Epichloe festucae (strain E2368) OX=696363 GN=fetC PE=2 SV=1
sp|E9R598|FETC_ASPFU	1.16e-68	43	488	25	458	Iron transport multicopper oxidase fetC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=fetC PE=2 SV=1
sp|Q99056|LAC5_TRAVI	3.05e-67	42	488	28	462	Laccase-5 OS=Trametes villosa OX=47662 GN=LCC5 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000360	0.999595	CS pos: 22-23. Pr: 0.9778

TMHMM  Annotations     

There is no transmembrane helices in GLOIN_2v1739402-t44_1-p1.