CAZyme Information: GLOIN_2v1705027-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1705027-t44_1-p1
• CAZy Family: GT2
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		62455.44	9.5519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000348:64918-66920(+)

Full Sequence      

MIKRKPLLILLLNLIFYVNVNTATTQNYIPIKDDFDRSGIPKNILLGSYVGGRSHVKPML
DVVAILIERGYNVTLLASGRYEPSSEYPGLNQITLGPRLGVKELRRTITYEEHYKRFSRF
IEISRNGYKETYEKYKKAAIEYNIDLFFCDVLGNDACIDIANNLKKPVVVWSSGLQLTDP
VPYKNDPLYGCNISLENESFFERFRCALIQPLQIAYTMGRIGPPAHQLNNIRELMNINTS
SGQMPKVSLSLVDTFFGFELPQPLPPNVQEVGPVLSKEYPPLTPELSNFINTHKRVLYVA
FGTRFITNTENNNKILQSFVEAINRKIVDGVVWPLIETSKDNFYPTLKLTDGTQMQTLPI
LNNKHPHIHITKFVPQFAVLNHTNTKLFFSHGGAGSTHESLYTGTPMLVLPLGGDQMGNS
QKLKSAGVALTLNELALDVSDILNKMSILLEDEKIKKNIKKMEVLTKINSRRKYRAADLI
EYILHSSGLEEYVNDDFLKEWAPAPSRMGFIKANNLDVYGALLGIFLTLIGGIAFKLFKL
ISNSSSIKIKSKKA

Enzyme Prediction     

No EC number prediction in GLOIN_2v1705027-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	260	462	5.9e-29	0.4397905759162304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.77e-47	43	483	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	1.12e-29	54	539	11	483	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	2.31e-25	230	461	238	441	ecdysteroid UDP-glucosyltransferase; Provisional
224732	YjiC	7.26e-17	44	481	4	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
177813	PLN02152	6.45e-09	245	465	198	432	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	6.01e-54	3	553	2	544
QKD47039.1|GT1	6.36e-54	42	519	9	502
CEI64654.1|GT1	8.83e-53	42	518	10	502
QGI59140.1|GT1	1.66e-52	42	534	9	515
QGI90050.1|GT1	1.66e-52	42	534	9	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	2.91e-14	272	462	19	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	6.81e-13	275	461	1	164	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	1.86e-12	281	462	6	164	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
2IYF_A	7.92e-09	367	481	284	395	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
4M83_A	7.92e-09	367	481	284	395	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9TSL6|UDB23_MACFA	2.78e-22	54	530	34	505	UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis OX=9541 GN=UGT2B23 PE=1 SV=1
sp|Q6ZQM8|UD17_MOUSE	3.75e-22	137	530	132	501	UDP-glucuronosyltransferase 1A7 OS=Mus musculus OX=10090 GN=Ugt1a7 PE=1 SV=1
sp|O02663|UD2B9_MACFA	4.96e-22	54	530	34	505	UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis OX=9541 GN=UGT2B9 PE=2 SV=1
sp|Q9GLD9|UDB33_MACMU	8.84e-22	239	530	245	505	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|P06133|UD2B4_HUMAN	1.57e-20	239	530	245	505	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999726	CS pos: 22-23. Pr: 0.9736

TMHMM  Annotations     

Start	End
7	29
518	540