CAZyme Information: GLOIN_2v1705002-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1705002-t44_1-p1
• CAZy Family: GT2
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555		62457.52	9.2617

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000348:60552-62556(+)

Full Sequence      

MIKRNPILLLLMLSLNLVFHVNVNTATTQSYIPRKVDFDRSGIPKNILLGSYIGGRSHVK
PMLDVAAILIERGYNVTLLSAGRYEPSSEYPGLNQITLGPPMRIKDLKNVNIHEDSGFRG
LSQVTEMSINDYGKTYEKYKKVAIEYNIDLFFCDVLVNDACMDIANNLKKPVIAWSSFLQ
FMEPVPYKNDPMFGCNISLENESFFERFRCALIQPLQIAYTMAPLARQLNDARKQMNIKP
VSGKMPKVSLALVDTFFGFELPQHLAPNVQEIGPVLSKEYPPLTPELSNFMNAHERVLYV
AFGTRFFTTTENNNKILQSLVEAINKKIIDGVVWPLVETSKDNFYPTLNLTDGTQVQTLP
ILNNEHPHIHIANFAPQFSVLNHTNTKLFFSHGGAGSVHESLYTGTPMLILPFGADQIGN
SHKLKSIGVALTLNKLTLDVNDILNKISKLIEDEKIKKNLKRMEVLAKINSKRKYRAADL
IEYILQNSGLEEYINDDFLKEWEPAGSRMGFIKANNFDVYGVILGVVLTLFGGIAFKLFK
LISNSSSIKIKSKKA

Enzyme Prediction     

No EC number prediction in GLOIN_2v1705002-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	250	463	6.6e-27	0.47643979057591623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.69e-45	46	484	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	1.02e-27	245	540	223	483	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	1.54e-23	267	462	265	441	ecdysteroid UDP-glucosyltransferase; Provisional
273616	MGT	8.60e-23	53	485	3	390	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
224732	YjiC	6.71e-21	47	489	4	403	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47039.1|GT1	8.99e-61	45	524	9	506
CEI64654.1|GT1	2.48e-60	45	535	10	516
QPC66669.1|GT1	1.29e-59	45	535	10	516
CZS76244.1|GT1	2.50e-59	45	535	10	516
CEF72977.1|GT1	2.50e-59	45	535	10	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	1.58e-14	273	463	19	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	1.99e-13	276	460	1	162	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	1.37e-12	282	463	6	164	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
2IYF_A	2.57e-09	368	482	284	395	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
4M83_A	2.57e-09	368	482	284	395	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9TSL6|UDB23_MACFA	4.99e-22	245	529	250	503	UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis OX=9541 GN=UGT2B23 PE=1 SV=1
sp|Q9GLD9|UDB33_MACMU	5.02e-21	245	529	250	503	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|P06133|UD2B4_HUMAN	2.11e-20	241	529	246	503	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q6K1J1|UDB31_CANLF	3.78e-20	245	529	251	504	UDP-glucuronosyltransferase 2B31 OS=Canis lupus familiaris OX=9615 GN=UGT2B31 PE=1 SV=1
sp|P54855|UDB15_HUMAN	8.93e-20	245	529	251	504	UDP-glucuronosyltransferase 2B15 OS=Homo sapiens OX=9606 GN=UGT2B15 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.018182	0.981781	CS pos: 25-26. Pr: 0.9198

TMHMM  Annotations     

Start	End
517	539