CAZyme Information: GLOIN_2v1701873-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1701873-t44_1-p1
• CAZy Family: GT2
• CAZyme Description: glycoside hydrolase family 63 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	AUPC02000327|CGC1	93365.36	5.0210

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000327:90371-94474(-)

Full Sequence      

MFIFNLIYILLFIRISLTEYVDYQKTSILAASNDSLLWGTYRPNLYFGTRPRLPESLLTG
LIWFGIENASSFSQIRHACDQGDGLDEYSFKKHDGRNFAIQTLSDSKNNIKLKTELLKNS
GGGHGGDWAVRISGTPINNNKPSGISFLYYFGLEGDGSIELTNPLDEMGLDTQVELKGET
PDLGQFSIILKEDPNNRMPSNVHSKASELADLSKIHYWGRLVPDGDIWRAKELLQGHLIS
KYQNIIKNPETKSIPPPKYLFALKNEVKENSNFFIFQKMIEGPFQFDIIFQSNSSPIHLD
SESLTSGLKSKSQEFDQRFEKTFGLREKGFNDSQIYFAQTIMSNLIGGIGYFYGSSIVDR
SFTDSDEDEEEFWTKYREADPRLTPPLALFTATPSRPFFPRGFYWDEGFHQLLIGKWDND
LSLDIIKHWVSLIDNDGWVAREQILGEEARSKVPEEFQIQYPHYANPPTLLMAIKSFMLR
VDNLENKNTINIDDIGEQIFSDHILSTTDPTIISSRFMLDKKLANDFLKEIYPKLKLNYK
WFRRTQWGEVKEWGRRARSREAYRWRGRTPGHTLTSGLDDYPRPTPPHPAELHVDLMCWV
GFMARSLKEIAERLEEEDDADDYTKEYKNIVANLNDLHWSEEHDAFCDLSVDEDEDSIFV
CHKGYLSLFPMVLELLPNDSPKLGAILDMIYNPSELWSKYGLRSLSKSDRFFHTGEDYWR
GNVWMNINYLVLSSLYKNYAAIEGPYKEKAKTIYKELRINIIENVYKEFERTGYVWEQYS
EDTGVGLRSHPFTGWTSLVTLIMAEEY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	590	805	1e-29	0.4368421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	299	805	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.31e-82	36	255	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	3.08e-08	526	776	359	588	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13455.1|GH63	3.51e-295	31	807	37	804
CCA74001.1|GH63	6.58e-269	24	807	24	801
CDR44291.1|GH63	8.37e-269	29	807	33	807
QRW00106.1|GH63	2.57e-264	62	807	1	744
QRW14633.1|GH63	1.47e-263	62	807	1	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.39e-172	22	805	6	802	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	4.06e-153	36	807	37	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	3.50e-211	31	807	37	808	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	8.79e-173	17	805	31	832	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	2.19e-156	36	807	92	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	5.23e-154	38	807	94	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.05e-150	36	807	94	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.661192	0.338805

TMHMM  Annotations     

There is no transmembrane helices in GLOIN_2v1701873-t44_1-p1.