CAZyme Information: GLOIN_2v1560487-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1560487-t44_1-p1
• CAZy Family: GH24
• CAZyme Description: glycosyltransferase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	AUPC02000055|CGC1	59895.34	8.5147

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000055:283147-285019(-)

Full Sequence      

MNKRNFIFLLSIFLLILVFYVDVSTSTQNHTSKNILIGSFVGGRSHVNPMLDIAVLLYER
GYNIILVATESHSLSLEYPTLKHVPLRARPYDFSYIKIVRESFHKEYNYKNLAALHEFHI
KSYNYVFEVYKNTAEEFDVDLFFCDALLNDACLDVANTLKKPVVGYTVNLNALVTSMHKS
DPTLKCHVSLENVSFFERFRCVIIEPIRLLYLTYPFINRLNDARKQINVESVFTSAGRLL
RTSLVLVDTFFGFEVPQTLPPNIQEIGPVMSEEYPSLTPELDDFLNGHKRVLYVSFGTRF
FTTIENNNKLLKAFIEAIDKKIIDGVIWTLVLTSKDDFSPTLNLIDGTAIQTSSILNNKH
PHIHISKFGPQFSILNHNNTKLFLSHGGTISCHESLYTGTPMLVFPFAYDQAGNAEKLKL
NGVGLILSKLNLDVNDVISKIDLLLKDENVKKNVKRLKFLSMINSKRKYRAADLIEYTLH
DSHNKGTSKGFLNDWIPKARFFEGDVNIYVALLSVIFGLRLIGIGI

Enzyme Prediction     

No EC number prediction in GLOIN_2v1560487-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	259	458	2.7e-24	0.4319371727748691

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.09e-42	34	477	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.47e-17	32	476	1	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	6.28e-17	260	458	264	443	ecdysteroid UDP-glucosyltransferase; Provisional
278624	UDPGT	3.07e-14	45	477	11	439	UDP-glucoronosyl and UDP-glucosyl transferase.
177813	PLN02152	9.09e-09	245	419	200	385	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC75432.1|GT1	6.32e-49	33	481	10	469
QKD47039.1|GT1	1.64e-48	33	481	9	468
CEI64654.1|GT1	6.11e-48	244	481	228	469
QKD56593.1|GT1	1.34e-47	27	489	2	474
QPC66669.1|GT1	1.12e-46	244	481	228	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	5.61e-11	267	457	19	186	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	1.37e-09	277	454	8	162	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
5NLM_A	1.95e-08	139	418	122	403	Chain A, indoxyl UDP-glucosyltransferase [Persicaria tinctoria],5NLM_B Chain B, indoxyl UDP-glucosyltransferase [Persicaria tinctoria]
6SU6_A	2.02e-08	139	418	143	424	Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU6_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU7_A Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_C Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_D Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria]
2O6L_A	5.77e-08	277	457	7	164	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19224|UD16_HUMAN	1.68e-15	45	460	37	445	UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2
sp|Q6K1J1|UDB31_CANLF	2.14e-14	191	457	204	446	UDP-glucuronosyltransferase 2B31 OS=Canis lupus familiaris OX=9615 GN=UGT2B31 PE=1 SV=1
sp|Q22295|UGT50_CAEEL	4.91e-14	182	460	190	453	Putative UDP-glucuronosyltransferase ugt-50 OS=Caenorhabditis elegans OX=6239 GN=ugt-50 PE=1 SV=2
sp|A0A291PQH4|UGT2_DACCO	8.46e-14	239	457	234	429	UDP-glucosyltransferase 2 OS=Dactylopius coccus OX=765876 GN=UTG2 PE=1 SV=1
sp|Q9HAW8|UD110_HUMAN	8.78e-14	191	460	199	443	UDP-glucuronosyltransferase 1A10 OS=Homo sapiens OX=9606 GN=UGT1A10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.078150	0.921826	CS pos: 26-27. Pr: 0.7627

TMHMM  Annotations     

Start	End
5	27