CAZyme Information: GLOIN_2v1512308-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1512308-t44_1-p1
• CAZy Family: CE4
• CAZyme Description: glycoside hydrolase family 35 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1053		120669.26	7.2266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000015:3490-6900(+)

Full Sequence      

MIAEVIAVTVTALAIPTGFVAFYVWLLQSRKGTLPITTTECAYNRNKYGHILDWDKHCLY
IHKNPTLIFSGEFHYWRLPDQSRWESVLKKYRAGGFNCIRIYFHWGFHNPDQGIYKFDGN
RDVNHLLNLCEKLGLYVLAAPGPYICAETQVGGFPLWLAAEKHRIRHIKFTGFKEYDKTF
AEYEKEWFENILPILARHQITEKSNGCVIALQIENELFEKARKIPFGLHDEMRFLCKVAR
DCGITVPLFTNDPDESGSFIAKPEYDAKPSTNFFNRRSFGLDLYGFDKYFIFAPSDSPAP
FDFCSEQDPKKWKPWDPKDMVNALDHLEKEVRSFGHDAAKSPIFIPELQGGWYTSYKSKH
TFDDIYNFYGDRFTRIVYDSVLAQGCTMLSFYMVYGGTNWGTLGDIDGTTSYDYSACIRE
SGYISARLRNLRLGLFFARSFSDVFAKTVRVKNPNIRASIKNVFNLQRRAVVDSGEESNA
VVFTFLRNFSKTESPKFELFVNYIGAQGKKVLFGMQCYLPYKSSFIALGNYVTSTGLKLI
FSSIPIHLRILHPPSGSDPGREIWIIPVNDGGEFAFEGEINVDGNLRSSVRNIGDSINIV
SFNDGIGFARIRHAEDSKELIILALDNDSLGTLHAVFDEPHWAQAHNRAFNLSHSPLIVS
WGTQNVYFDLENNTIETEYGEVEKEITILSLRQLSDHTRVDSNSFYSLPFIYKKQLNKPS
AVHTTPELFNWSTRITNFSDLEWREIDLKNGGAAENHYASGHVLYRAKFPSMKKNRKIQL
NVNMRHRCTIFVNGKFAGGHMTFSKNLFFPGVKMGPELFASLGDKKYDITKFVNVNEEDN
IIIILVDNLGISRQSVVFNDARNPRGLISAKISGLSKVKWEICGVDVRKLEIPFITSGFP
DEHKNTGWIESSSISDYGVMPDEGVKWWSFKFKHPVDPKYKEIINSPLRLVLFGAFTSFI
FLNDTLIGRYYGNGDFSQHNYYLMDGLLKFNEENKITLMVYSWEQVHSNDIKVEVRGWEI
DDVNKSGNIIEIPEDANDDHKSWVVMREKIKLN

Enzyme Prediction     

No EC number prediction in GLOIN_2v1512308-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	59	432	2.2e-76	0.9804560260586319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	4.28e-65	59	431	2	314	Glycosyl hydrolases family 35.
166698	PLN03059	2.37e-23	54	431	32	338	beta-galactosidase; Provisional
224786	GanA	2.39e-19	59	216	8	160	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
404274	BetaGal_dom4_5	7.16e-06	898	1000	11	105	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
395098	Cellulase	0.004	64	138	6	82	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09169.1|GH35	3.63e-303	15	1030	12	1011
UPG93009.1|GH35	5.38e-73	37	1005	24	930
URZ04686.1|GH35	7.52e-73	50	1002	57	938
URZ18469.1|GH35	3.99e-71	50	1002	57	938
URZ13974.1|GH35	7.33e-71	50	1002	57	938

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	2.00e-47	54	1004	8	932	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
3OG2_A	4.66e-45	50	420	24	350	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
5IFP_A	4.80e-45	54	884	48	838	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.11e-44	54	884	48	838	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	2.03e-41	45	450	39	401	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6RPN7|BGALB_BOTFB	2.00e-54	28	1020	20	978	Probable beta-galactosidase B OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=lacB PE=3 SV=1
sp|Q2U6P1|BGALB_ASPOR	1.20e-53	38	1026	26	999	Probable beta-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacB PE=3 SV=2
sp|B6GW04|BGALB_PENRW	6.40e-53	39	1023	27	1001	Probable beta-galactosidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacB PE=3 SV=2
sp|B8NKI4|BGALB_ASPFN	1.17e-52	38	1026	26	997	Probable beta-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacB PE=3 SV=2
sp|B0Y752|BGALC_ASPFC	1.73e-52	54	884	34	812	Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998960	0.001086

TMHMM  Annotations     

Start	End
5	27