CAZyme Information: GLOIN_2v1466362-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1466362-t44_1-p1
• CAZy Family: AA5
• CAZyme Description: glycosyltransferase family 49 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	AUPC02000377|CGC1	41362.92	6.7775

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000377:64009-65293(-)

Full Sequence      

MTEEFFLSKVFSESMQPSHVIPYYFRAVKTPKEEDITITTLITENRFHVFDRLVTNYQGP
ISVTIHVADDEKSRDVLLSKLHDLYNGNEYMKQYVDVHLVVDNFERQFNMWRNVAKFFAR
TNYVMMLDVDFHPCTDFRHAILNNEEIMKKLRTGNTALVVPAFEYADLQEGLDFHTFPTK
KADALELVESGRLVMFHASWKPGHGPSNYTHWYGTNELYKVTTYQYQYEPYVIFPKQSIW
CDERFVGYGANKAACLFELYLSGVDYWVLPNDFLIHQTHEYLEDARRHERRFNKKLYDHF
REELCFRYARNFILNDEWKTEKADNLKNTCNKIRGFSQAIKYFSSMK

Enzyme Prediction     

No EC number prediction in GLOIN_2v1466362-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	28	309	4.6e-44	0.8367952522255193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	4.93e-60	35	308	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06217.1|GT49	4.73e-153	1	340	92	431
CDS09884.1|GT49	1.77e-152	1	340	51	390
CDS06289.1|GT49	2.23e-151	1	340	82	421
CDS10115.1|GT49	9.39e-147	1	340	87	426
CDS14203.1|GT49	4.09e-145	1	340	84	424

PDB Hits     

GLOIN_2v1466362-t44_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66PG1|LARG2_DANRE	1.37e-28	23	279	453	702	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1
sp|Q66PG4|LARG2_CHICK	1.82e-28	19	279	440	691	Xylosyl- and glucuronyltransferase LARGE2s OS=Gallus gallus OX=9031 GN=LARGE2 PE=2 SV=1
sp|Q5XPT3|LARG2_MOUSE	1.42e-27	31	309	398	673	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q32NJ7|LRG2B_XENLA	1.48e-27	30	309	435	710	Xylosyl- and glucuronyltransferase LARGE2s OS=Xenopus laevis OX=8355 GN=large2-b PE=2 SV=1
sp|Q6P7A1|LARG2_RAT	2.60e-27	31	279	397	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GLOIN_2v1466362-t44_1-p1.