CAZyme Information: GLOIN_2v1447637-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1447637-t44_1-p1
• CAZy Family: AA1
• CAZyme Description: Cupredoxin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		70235.26	8.9877

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000009:458251-460439(-)

Full Sequence      

MKLNLKKVSILFISLFVICSSAIPARIHNVDNDEHLHLRAYTNEIQKRHEPFKIIQTDYF
KPFVHLPFTNKPVTRYYQLTLKKVKLSPDGFERTVWSVNGQYPAPIIRANKGDRMIINVE
NKFGDPAAVHWHGVFQHGTNWYDGVPGQTQCPIPNDVSFIYNFTTGDQHGTFWYHSHFMA
QYADGLRGALIVHDPDDPYLKEYDYEYVITLSDWHHRTTGEILPNFISPTYTGKRPVPDS
PLLSGRGRYNFYNVKKNKKYRFRIINSAADAFFIFSIDEHKLKLIESEGIYIKPTIIEKL
PINVGQRYSVIVNADQPIGKYWIRATIDKRCVLINNATINFNSSIDWNGLGILKYEGSKN
DKPKSKEFPENFKICRDPDPKHLKTLQPVTKYDGNVSDFFNITVKFQREGDGIVKAVMNN
SSFIPQFNDPTINKIIRHIPPDELPKEQNSLIFDNKNGIVEIALWNNNTDEHPFHMHGHV
FGVMFVGEKNEYPDEKKYDKKNPVIRDNVTVPGFGYLVIRFIADNPGIWAFHCHIEWHVE
LGMVLQLVELPSILMNETIPNDASSLCFKNDYQKKRNPTTPFHNRERMFNPVIINEIRRD
INKIR

Enzyme Prediction     

EC	1.10.3.2:4	1.10.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	91	543	5.2e-111	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	2.13e-90	74	543	1	517	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
215324	PLN02604	8.02e-80	74	555	24	559	oxidoreductase
177843	PLN02191	5.18e-75	87	549	36	546	L-ascorbate oxidase
225043	SufI	4.44e-68	89	551	48	450	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
274556	laccase	3.28e-64	74	560	3	530	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY56171.2|AA1_1	6.93e-100	63	567	13	502
QKX53525.1|AA1	5.69e-99	72	526	104	587
AUS45844.1|AA1	9.11e-99	74	567	122	655
QNP95316.1|AA1	1.50e-98	69	567	143	678
AOW00922.1|AA1	2.11e-98	69	567	143	678

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2HRG_A	1.09e-92	79	567	8	485	Crystal Structure of Blue Laccase from Trametes trogii complexed with p-methylbenzoate [Coriolopsis trogii],2HRH_A Crystal Structure of Blue Laccase from Trametes trogii [Coriolopsis trogii]
4JHU_A	2.15e-92	72	567	4	485	T2-depleted laccase from Coriolopsis caperata soaked with CuCl [Coriolopsis caperata],4JHV_A T2-depleted laccase from Coriolopsis caperata [Coriolopsis caperata]
6H5Y_A	1.18e-91	79	567	8	485	PM1 mutant, 7D5 [Aspergillus oryzae],6H5Y_B PM1 mutant, 7D5 [Aspergillus oryzae]
5EHF_A	9.35e-91	79	567	8	486	Laccase from Antrodiella faginea [Antrodiella faginea]
5ANH_A	1.28e-90	79	567	8	485	Crystal Structure Of Laccase From Basidiomycete Pm1 (cect 2971) [basidiomycete PM1],5ANH_B Crystal Structure Of Laccase From Basidiomycete Pm1 (cect 2971) [basidiomycete PM1],5ANH_C Crystal Structure Of Laccase From Basidiomycete Pm1 (cect 2971) [basidiomycete PM1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12541|LAC1_AGABI	5.11e-93	74	567	21	509	Laccase-1 OS=Agaricus bisporus OX=5341 GN=lcc1 PE=1 SV=1
sp|Q12542|LAC2_AGABI	1.18e-90	74	567	21	509	Laccase-2 OS=Agaricus bisporus OX=5341 GN=lcc2 PE=1 SV=1
sp|Q01679|LAC1_PHLRA	6.97e-89	72	567	25	509	Laccase OS=Phlebia radiata OX=5308 GN=LAC PE=1 SV=2
sp|Q02081|LAC4_THACU	1.99e-87	75	552	23	499	Laccase-4 OS=Thanatephorus cucumeris OX=107832 GN=LCC4 PE=1 SV=1
sp|K7NCS2|FETC_EPIFE	3.92e-86	84	567	32	514	Iron transport multicopper oxidase fetC OS=Epichloe festucae (strain E2368) OX=696363 GN=fetC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001913	0.998071	CS pos: 22-23. Pr: 0.6218

TMHMM  Annotations     

There is no transmembrane helices in GLOIN_2v1447637-t44_1-p1.