CAZyme Information: GLOIN_2v1429650-t44_1-p1

Basic Information

• Species: Rhizophagus irregularis
• Lineage: Mucoromycota; Glomeromycetes; ; Glomeraceae; Rhizophagus; Rhizophagus irregularis
• CAZyme ID: GLOIN_2v1429650-t44_1-p1
• CAZy Family: AA1
• CAZyme Description: alginate lyase domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		32221.60	9.1071

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RirregularisDAOM181602	26245	747089	102	26143

• Gene Location: location=AUPC02000186:179966-180787(-)

Full Sequence      

YSVTLKNSLPPSNDPHDYMSLSRYFWPNPDKPNGLPYIRIDGIENPEIYTIPDYTLMRDL
FKEIGNLGFAYFFTNNNSYVEKALYRINEWFIDEKTRMNPNLNYAGFRKGDIIGRRTGVL
DIRPVFRMLQSIPLMRSSSKWNFVIEKKLRRWFSEYYTWLTTSPIGIKAKEDGFNNHGTH
YDVQVTFILSFLGHDEQARTYSKQALINRINIGILPSGEQPFETRRMLSWHYSIFNLQAL
FLLAERADHYGYNDAWTYVGNDGQTLKKAVDYIL

Enzyme Prediction     

No EC number prediction in GLOIN_2v1429650-t44_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	3	273	2.9e-90	0.9605734767025089

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.17e-67	2	274	1	265	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCH01052.1|PL38	4.10e-70	1	274	75	346
QMU30997.1|PL38	1.63e-69	1	274	79	350
UPK66657.1|PL38	1.13e-67	1	274	73	344
QIP15531.1|PL38	5.85e-67	1	274	71	342
QBN17441.1|PL38	5.27e-66	1	274	77	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	4.50e-47	2	274	47	318	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

GLOIN_2v1429650-t44_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GLOIN_2v1429650-t44_1-p1.